LXL04_033148 | RubberDandelionOmics

Gene overview

LXL04_033148

Reference: OH-1004 Chr: Chr07 Coordinates: 37131518-37133413 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · LXL04_033148|LXL04_033148|OH1004|cDNA

ATGGGTATTTGTGTGGGAAAGCCAGCCAATGTTGCTCATGCGTCTTCAGGTCAATTTCTGGACGAAATGATTAACAACAAGATAAAATCCAGCTCAAAAGATTCCAAGAATCAGAACAAACCAGTCACCTTCAACAAAGTTTCAAAAACACCCAAATATGATAACCTCCCTGTCCCCATTAACCTCAAAGCCTTCAGCTTGAGCGATCTCAAGACCGCCACCAAAAACTTCCGGCCAGATAGCCTACTAGGCGAGGGCGG...

CDS

Download CDS FASTA

1134 bp · LXL04_033148|LXL04_033148|OH1004|CDS

ATGGGTATTTGTGTGGGAAAGCCAGCCAATGTTGCTCATGCGTCTTCAGGTCAATTTCTGGACGAAATGATTAACAACAAGATAAAATCCAGCTCAAAAGATTCCAAGAATCAGAACAAACCAGTCACCTTCAACAAAGTTTCAAAAACACCCAAATATGATAACCTCCCTGTCCCCATTAACCTCAAAGCCTTCAGCTTGAGCGATCTCAAGACCGCCACCAAAAACTTCCGGCCAGATAGCCTACTAGGCGAGGGCGG...

Protein

Download Protein FASTA

377 aa · LXL04_033148|LXL04_033148|OH1004|PROTEIN

MGICVGKPANVAHASSGQFLDEMINNKIKSSSKDSKNQNKPVTFNKVSKTPKYDNLPVPINLKAFSLSDLKTATKNFRPDSLLGEGGFGRVFKGWIDETTFAPVKPGTGLVVAVKILKAESRQGHREWLTELEYLGRLHHKNLVKLIGYCEECENRLLVYEYMPKGCLDNHLFRKSVQPMPWATRMRIAIDVAEGLAFLHSKEPCIIYRDLKASNILLDMEFNAKLSDFGLARNGPVGDNTHVSTRVVGTNGYAAPEYIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033148`
TK1151 ID	TkA08G235020
OH-1004 ID	LXL04_033148
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033148

Location Chr07:37131518-37133413 (-)

Description Similar to PBL3: Probable serine/threonine-protein kinase PBL3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02800`	May be involved in plant defense signaling.	No verified direct reference in this release
`At1g69790`	May be involved in plant defense signaling.	No verified direct reference in this release
`At1g14370`	Involved in disease resistance signaling.	Receptor-like cytoplasmic kinases integrate signaling from multiple plant immune receptors and are targeted by a Pseudomonas syringae effector.2010 · DOI: 10.1016/j.chom.2010.03.007 xopAC-triggered immunity against Xanthomonas depends on Arabidopsis receptor-like cytoplasmic kinase genes PBL2 and RIPK.2013 · DOI: 10.1371/journal.pone.0073469 The Decoy Substrate of a Pathogen Effector and a Pseudokinase Specify Pathogen-Induced Modified-Self Recognition and Immunity in Plants.2015 · DOI: 10.1016/j.chom.2015.08.004 Ligand-triggered allosteric ADP release primes a plant NLR complex.2019 · DOI: 10.1126/science.aav5868
`At1g26970`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g02290`	May play a role in the regulation of plant growth and development (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033148 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030957 Tat protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G14370

ath:AT1G26970

ath:AT1G69790

ath:AT2G02800

ath:AT5G02290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.742

Rank 1 · LXL04_033148 · OH-1004

Cytoplasm0.210

Rank 2 · LXL04_033148 · OH-1004

Nucleus0.198

Rank 3 · LXL04_033148 · OH-1004

Endoplasmic reticulum0.039

Rank 4 · LXL04_033148 · OH-1004

Golgi apparatus0.025

Rank 5 · LXL04_033148 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase80-356 aa

PF07714.24PK_Tyr_Ser-Thr81-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033148	`PF00069.32`	Pkinase	80	356	3e-46	158.7
LXL04_033148	`PF07714.24`	PK_Tyr_Ser-Thr	81	357	2.1e-47	162.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49840`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL3	66.337%	Swiss-Prot	strong database homology
`Q5XF79`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL18	58.221%	Swiss-Prot	strong database homology
`O49839`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL2	64.686%	Swiss-Prot	strong database homology
`Q5PP29`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL4	57.453%	Swiss-Prot	strong database homology
`P43293`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL11	63.291%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card