LXL04_033132 | RubberDandelionOmics

Gene overview

LXL04_033132

Reference: OH-1004 Chr: Chr07 Coordinates: 36871805-36873853 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1656 bp · LXL04_033132|LXL04_033132|OH1004|cDNA

ATGGCGTTAGACTTTGGATCCGCTAGCAAAGAAAGATTGTTATCTCGCAAGGCCTTATTCGAAGAGTACGATCACAACAACAAGAACAAAGACGACGATGATTCTTCCCTCCTCGATAGAATCACCAAATCATGGGAAGATCTTCTCGAGTTTCTCACCAAGGTTTACGAAATGGGTCGGGCCGACCCACGACAGATCATCTTCGCTGCTAAATCCGGCCTCGCACTTGCTTTTGTTTCCATCCTCATCTTTTTCAAAGA...

CDS

Download CDS FASTA

1656 bp · LXL04_033132|LXL04_033132|OH1004|CDS

ATGGCGTTAGACTTTGGATCCGCTAGCAAAGAAAGATTGTTATCTCGCAAGGCCTTATTCGAAGAGTACGATCACAACAACAAGAACAAAGACGACGATGATTCTTCCCTCCTCGATAGAATCACCAAATCATGGGAAGATCTTCTCGAGTTTCTCACCAAGGTTTACGAAATGGGTCGGGCCGACCCACGACAGATCATCTTCGCTGCTAAATCCGGCCTCGCACTTGCTTTTGTTTCCATCCTCATCTTTTTCAAAGA...

Protein

Download Protein FASTA

551 aa · LXL04_033132|LXL04_033132|OH1004|PROTEIN

MALDFGSASKERLLSRKALFEEYDHNNKNKDDDDSSLLDRITKSWEDLLEFLTKVYEMGRADPRQIIFAAKSGLALAFVSILIFFKEPLHYIRQYCIWAILTVIVVFEFSIGATLSKGFNRILGTFSAAVLALGFAQLSIWAGEWHEFVVVISIFIAGSISTYIKLYPSMKPYEYAFRVFMLTFSIVLVSGSSHFFTTAASRLLLVIVGAGICLVVNICIYPIWSGEELHKLVVKNFRGVATSLEECVRSYLQNVEYERI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033132`
TK1151 ID	TkA08G233810
OH-1004 ID	LXL04_033132
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033132

Location Chr07:36871805-36873853 (-)

Description Similar to ALMT4: Aluminum-activated malate transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25480`	Malate transporter.	No verified direct reference in this release
`At2g17470`	Malate transporter.	No verified direct reference in this release
`At1g68600`	Malate transporter.	No verified direct reference in this release
`At3g18440`	Vacuolar malate channel.	The Arabidopsis vacuolar malate channel is a member of the ALMT family.2007 · DOI: 10.1111/j.1365-313x.2007.03367.x
`At1g18420`	Malate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033132 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015743 malate transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0071423 malate transmembrane transport Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT1G18420

ath:AT1G25480

ath:AT1G68600

ath:AT2G17470

ath:AT3G18440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.747

Rank 1 · LXL04_033132 · OH-1004

Endoplasmic reticulum0.111

Rank 2 · LXL04_033132 · OH-1004

Lysosome / Vacuole0.089

Rank 3 · LXL04_033132 · OH-1004

Cytoplasm0.067

Rank 4 · LXL04_033132 · OH-1004

Golgi apparatus0.039

Rank 5 · LXL04_033132 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744.15ALMT57-523 aa

PF13515.13FUSC_291-216 aa

PF04632.19FUSC98-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033132	`PF11744.15`	ALMT	57	523	7.8e-169	563.2
LXL04_033132	`PF13515.13`	FUSC_2	91	216	2.2e-11	44.7
LXL04_033132	`PF04632.19`	FUSC	98	251	7e-07	29.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6L8`	Arabidopsis thaliana	Aluminum-activated malate transporter 4	56.481%	Swiss-Prot	strong database homology
`Q9SHM1`	Arabidopsis thaliana	Aluminum-activated malate transporter 6	55.138%	Swiss-Prot	strong database homology
`Q93Z29`	Arabidopsis thaliana	Aluminum-activated malate transporter 5	56.238%	Swiss-Prot	strong database homology
`Q9LS46`	Arabidopsis thaliana	Aluminum-activated malate transporter 9	53.462%	Swiss-Prot	strong database homology
`Q9LPQ8`	Arabidopsis thaliana	Putative aluminum-activated malate transporter 3	50.459%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card