LXL04_033119 | RubberDandelionOmics

Gene overview

LXL04_033119

Reference: OH-1004 Chr: Chr07 Coordinates: 36538149-36540539 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2391 bp · LXL04_033119|LXL04_033119|OH1004|cDNA

ATGGCTCTAGTCCTACTGCACCTCGTCTTTCTATCTATTTTCCTACATTTGATAACTGCACAACAGACTGGCGGCTCTGTATCTGTTGGTTCATCACTCACCGCCACACCCAACGTTAACCCATGGGTACTTTCATCTTCCGGTGAGTTTGCCTTTGGGTTCAAACAAATTGAAGGGACCGATTACTTTTTGTTGTCAATATGGTATGACAAGATACCCGACAAGACCATCATTTGGTATCCAGAAGTAGGTACGATGGT...

CDS

Download CDS FASTA

2391 bp · LXL04_033119|LXL04_033119|OH1004|CDS

ATGGCTCTAGTCCTACTGCACCTCGTCTTTCTATCTATTTTCCTACATTTGATAACTGCACAACAGACTGGCGGCTCTGTATCTGTTGGTTCATCACTCACCGCCACACCCAACGTTAACCCATGGGTACTTTCATCTTCCGGTGAGTTTGCCTTTGGGTTCAAACAAATTGAAGGGACCGATTACTTTTTGTTGTCAATATGGTATGACAAGATACCCGACAAGACCATCATTTGGTATCCAGAAGTAGGTACGATGGT...

Protein

Download Protein FASTA

796 aa · LXL04_033119|LXL04_033119|OH1004|PROTEIN

MALVLLHLVFLSIFLHLITAQQTGGSVSVGSSLTATPNVNPWVLSSSGEFAFGFKQIEGTDYFLLSIWYDKIPDKTIIWYPEVGTMVPTGSKVELVRTTGLVLSDPQGTEVWRSGSISGVALGFMNDTGNFVIFGSNSRKIWDTFDFPANTLLPTQVMETGEGIKSTMSKTNFSGGRFQLRLLQDGNLVLNTRDILSGSPYDAYYISGTFDPSNSTNSGEQLIFDEMGYMYILRRSGERFDLTPNGSLPSGDYYHRAALD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033119`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033119

Location Chr07:36538149-36540539 (+)

Description Similar to LECRK3: G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60900`	G-type lectin S-receptor-like serine/threonine-protein kinase RLK1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q25AG3`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`Os04g0202500`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`UniProt: A2XQD3`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`Os04g0202300`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033119 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G60900

dosa:Os04g0202350

dosa:Os04g0202500

osa:9266608

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.824

Rank 1 · LXL04_033119 · OH-1004

Endoplasmic reticulum0.079

Rank 2 · LXL04_033119 · OH-1004

Cytoplasm0.069

Rank 3 · LXL04_033119 · OH-1004

Lysosome / Vacuole0.039

Rank 4 · LXL04_033119 · OH-1004

Extracellular0.034

Rank 5 · LXL04_033119 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin91-160 aa

PF00954.26S_locus_glycop253-325 aa

PF07714.24PK_Tyr_Ser-Thr511-776 aa

PF00069.32Pkinase512-774 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033119	`PF01453.31`	B_lectin	91	160	2.4e-08	35.1
LXL04_033119	`PF00954.26`	S_locus_glycop	253	325	3.9e-06	28.1
LXL04_033119	`PF07714.24`	PK_Tyr_Ser-Thr	511	776	1.1e-44	153.4
LXL04_033119	`PF00069.32`	Pkinase	512	774	6.6e-47	160.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39202`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase RLK1	45.324%	Swiss-Prot	moderate database homology
`Q25AG3`	Oryza sativa subsp. indica	G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3	44.987%	Swiss-Prot	moderate database homology
`Q0JEU6`	Oryza sativa subsp. japonica	G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3	44.987%	Swiss-Prot	moderate database homology
`A2XQD3`	Oryza sativa subsp. indica	G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2	43.067%	Swiss-Prot	moderate database homology
`Q7FAZ2`	Oryza sativa subsp. japonica	G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2	43.719%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card