LXL04_033048 | RubberDandelionOmics

Gene overview

LXL04_033048

Reference: OH-1004 Chr: Chr07 Coordinates: 35038147-35039937 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1791 bp · LXL04_033048|LXL04_033048|OH1004|cDNA

ATGATGTTTATATGGTTGCTTATTTTCATCAACTCGATCAACTCAAGCCATGAACAAGCATTCTATGACGCAACATCTTGTCGAGATGATGGCAATGCTCCAGGGACAAGGTACACTTGCACTAACACCACGTTGACCAAGATGTCATGCCAGACTTTCTTGATTTTCCGAACAAACCATCAGTTTCCGACCATCTCCACCATCGCCACCTTGTTTGGACTGCCACCCGACACCTTACTTGAGTTAAACGTCCACATAGA...

CDS

Download CDS FASTA

1791 bp · LXL04_033048|LXL04_033048|OH1004|CDS

ATGATGTTTATATGGTTGCTTATTTTCATCAACTCGATCAACTCAAGCCATGAACAAGCATTCTATGACGCAACATCTTGTCGAGATGATGGCAATGCTCCAGGGACAAGGTACACTTGCACTAACACCACGTTGACCAAGATGTCATGCCAGACTTTCTTGATTTTCCGAACAAACCATCAGTTTCCGACCATCTCCACCATCGCCACCTTGTTTGGACTGCCACCCGACACCTTACTTGAGTTAAACGTCCACATAGA...

Protein

Download Protein FASTA

596 aa · LXL04_033048|LXL04_033048|OH1004|PROTEIN

MMFIWLLIFINSINSSHEQAFYDATSCRDDGNAPGTRYTCTNTTLTKMSCQTFLIFRTNHQFPTISTIATLFGLPPDTLLELNVHIDSSSETLLTDKEVLVPVTCSCSDNFFQAKVNYTVTGNTTLSDTACGVFEGLVKTVTLLEENQNQEVFEVGFVLNVPLKCACPNNGYKYLVTYPLVSGDSVMPVSAKFGISIDDILAVNNLNLDTTVYPETTILVPLRSKPMLNFDVPIFRPPTPGFLPTKQTEGNIKSTKLKKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033048`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033048

Location Chr07:35038147-35039937 (-)

Description Similar to LYK4: LysM domain receptor-like kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23770`	Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity.	LYK4, a lysin motif receptor-like kinase, is important for chitin signaling and plant innate immunity in Arabidopsis.2012 · DOI: 10.1104/pp.112.201699
`At2g33580`	May recognize microbe-derived N-acetylglucosamine (NAG)-containing ligands.	No verified direct reference in this release
`At3g01840`	May recognize microbe-derived N-acetylglucosamine (NAG)-containing ligands.	No verified direct reference in this release
`At3g21630`	Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity toward both biotic and abiotic stresses (e.g. tolerance to salinity, heavy-metal stresses, and Botrytis cinerea infection).	CERK1, a LysM receptor kinase, is essential for chitin elicitor signaling in Arabidopsis.2007 · DOI: 10.1073/pnas.0705147104 AvrPtoB targets the LysM receptor kinase CERK1 to promote bacterial virulence on plants.2009 · DOI: 10.1016/j.cub.2009.01.054 The lysin motif receptor-like kinase (LysM-RLK) CERK1 is a major chitin-binding protein in Arabidopsis thaliana and subject to chitin-induced phosphorylation.2010 · DOI: 10.1074/jbc.m110.116657 Arabidopsis lysin-motif proteins LYM1 LYM3 CERK1 mediate bacterial peptidoglycan sensing and immunity to bacterial infection.2011 · DOI: 10.1073/pnas.1112862108 The LysM receptor-like kinase LysM RLK1 is required to activate defense and abiotic-stress responses induced by overexpression of fungal chitinases in Arabidopsis plants.2012 · DOI: 10.1093/mp/sss021 Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants.2012 · DOI: 10.1093/pcp/pcs113 Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27.2014 · DOI: 10.1111/tpj.12535

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033048 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002752 cell surface pattern recognition receptor signaling pathway Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009877 nodulation Biological Process

GO:0010200 response to chitin Biological Process

GO:0032491 detection of molecule of fungal origin Biological Process

GO:0032499 detection of peptidoglycan Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

KEGG gene cross-reference

ath:AT2G23770

ath:AT2G33580

ath:AT3G01840

ath:AT3G21630

mtr:11410973

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.741

Rank 1 · LXL04_033048 · OH-1004

Endoplasmic reticulum0.118

Rank 2 · LXL04_033048 · OH-1004

Cytoplasm0.084

Rank 3 · LXL04_033048 · OH-1004

Lysosome / Vacuole0.072

Rank 4 · LXL04_033048 · OH-1004

Nucleus0.057

Rank 5 · LXL04_033048 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23446.2LysM1_NFP_LYK49-107 aa

PF23472.2LysM2_CERK1_LYK3_4_5111-164 aa

PF23473.2LysM3_LYK4_5174-222 aa

PF23462.2LysM3_NFP174-221 aa

PF01476.27LysM182-221 aa

PF07714.24PK_Tyr_Ser-Thr384-457 aa

PF00069.32Pkinase384-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033048	`PF23446.2`	LysM1_NFP_LYK	49	107	1.8e-21	77.5
LXL04_033048	`PF23472.2`	LysM2_CERK1_LYK3_4_5	111	164	3.7e-13	49.9
LXL04_033048	`PF23473.2`	LysM3_LYK4_5	174	222	4.1e-12	46.7
LXL04_033048	`PF23462.2`	LysM3_NFP	174	221	8e-06	27.0
LXL04_033048	`PF01476.27`	LysM	182	221	1.6e-10	41.5
LXL04_033048	`PF07714.24`	PK_Tyr_Ser-Thr	384	457	5.1e-10	39.8
LXL04_033048	`PF00069.32`	Pkinase	384	457	1.7e-07	31.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64825`	Arabidopsis thaliana	LysM domain receptor-like kinase 4	30.667%	Swiss-Prot	moderate database homology
`O22808`	Arabidopsis thaliana	Protein LYK5	29.402%	Swiss-Prot	weak database homology
`Q9SGI7`	Arabidopsis thaliana	Protein LYK2	25.361%	Swiss-Prot	weak database homology
`A8R7E6`	Arabidopsis thaliana	Chitin elicitor receptor kinase 1	24.655%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card