LXL04_033013 | RubberDandelionOmics

Gene overview

LXL04_033013

Reference: OH-1004 Chr: Chr07 Coordinates: 33423532-33427393 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1869 bp · LXL04_033013|LXL04_033013|OH1004|cDNA

ATGGGGGAGCGTACTATGGCTTGGGTTAGTTGGGATGTGGTGTTATCGGCTAAGGAGCAAGGTGGTTTGGGGGTGGGTAGCCTCTTTGGCTTCAACCTCGCTTTGCTCCAAAAATGGAGATGGAGGTTTCATACGGCTACTGGAGGTAACTGGATTCGGGTCATACAAGCCATCCATAGTGTTTCTGGTGGGTTTGATCGCGGGGGCAGGAAGAGTGGTTTTGTGGGAATGTGGTCCAAAATAGTAGATTCGTCTATTCA...

CDS

Download CDS FASTA

1869 bp · LXL04_033013|LXL04_033013|OH1004|CDS

ATGGGGGAGCGTACTATGGCTTGGGTTAGTTGGGATGTGGTGTTATCGGCTAAGGAGCAAGGTGGTTTGGGGGTGGGTAGCCTCTTTGGCTTCAACCTCGCTTTGCTCCAAAAATGGAGATGGAGGTTTCATACGGCTACTGGAGGTAACTGGATTCGGGTCATACAAGCCATCCATAGTGTTTCTGGTGGGTTTGATCGCGGGGGCAGGAAGAGTGGTTTTGTGGGAATGTGGTCCAAAATAGTAGATTCGTCTATTCA...

Protein

Download Protein FASTA

622 aa · LXL04_033013|LXL04_033013|OH1004|PROTEIN

MGERTMAWVSWDVVLSAKEQGGLGVGSLFGFNLALLQKWRWRFHTATGGNWIRVIQAIHSVSGGFDRGGRKSGFVGMWSKIVDSSIHLANTGVVPLTVLARRIGRGDTIKFWEDVWVCDQPLKTRFNRLFRLEELPSCLVSDKWGGGQWSWSWSRPITGGRLSAQLLELHELLRDVVISSNPDKWWWDLDTSGGFSVRVTRRCIDDLRLSGLPYPTRWYKAIPRRVNIFLWRAMIDRLPTRFNLSLRGMDLPLIGCPVCA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033013`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033013

Location Chr07:33423532-33427393 (-)

Description Similar to GLXI: Lactoylglutathione lyase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08110`	Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033013 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0019243 methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004462 lactoylglutathione lyase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G08110

cam:101505694

gmx:547667

sly:544161

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.353

Rank 1 · LXL04_033013 · OH-1004

Nucleus0.250

Rank 2 · LXL04_033013 · OH-1004

Plastid0.247

Rank 3 · LXL04_033013 · OH-1004

Cell membrane0.105

Rank 4 · LXL04_033013 · OH-1004

Peroxisome0.097

Rank 5 · LXL04_033013 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00903.32Glyoxalase464-605 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033013	`PF00903.32`	Glyoxalase	464	605	2.9e-23	83.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0V3`	Arabidopsis thaliana	Lactoylglutathione lyase	77.348%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card