RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_032988
Reference: OH-1004 Chr: Chr07 Coordinates: 32892724-32896714 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1737 bp · LXL04_032988|LXL04_032988|OH1004|cDNA

ATGATTGTTGAGCAGAAAGTGAAGGAAGCAGAGATTACTGAGCAGGATTCTCTTCTCCTATTCTTATATCTCATGATTTATTTCCTTTCAAAACAGACAAGGAACCTACTACGTATAGCAATATTCAATATCAGTTATATCAGAGGTCTTTTTCCTGAGAAATACTTCAGCGATAAGGGTGTCCCAGCCTTAGAGATGAAGATCAAAAAGCTTATGCCTATGGATGCAGACTCCAGAAGACTAATTGACTGGATGGAGAA...

CDS

Download CDS FASTA

1737 bp · LXL04_032988|LXL04_032988|OH1004|CDS

ATGATTGTTGAGCAGAAAGTGAAGGAAGCAGAGATTACTGAGCAGGATTCTCTTCTCCTATTCTTATATCTCATGATTTATTTCCTTTCAAAACAGACAAGGAACCTACTACGTATAGCAATATTCAATATCAGTTATATCAGAGGTCTTTTTCCTGAGAAATACTTCAGCGATAAGGGTGTCCCAGCCTTAGAGATGAAGATCAAAAAGCTTATGCCTATGGATGCAGACTCCAGAAGACTAATTGACTGGATGGAGAA...

Protein

Download Protein FASTA

578 aa · LXL04_032988|LXL04_032988|OH1004|PROTEIN

MIVEQKVKEAEITEQDSLLLFLYLMIYFLSKQTRNLLRIAIFNISYIRGLFPEKYFSDKGVPALEMKIKKLMPMDADSRRLIDWMEKGVYDALQKKYLRTLMFCVCQTVEGPMIEEYSFSFSYSNSDSQEVSMNVNRIGNKKQGETFKCNSTTEITPNQMKSSACKMVRTLIQLMRTLDKMPEERTILMKLLYYDDVTPADYEPPFFRGCTEEEANNPWNKNPLKMEVGNVNSKHFVLSLKVKSVLDPCEDENMSVGGDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_032988
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_032988
LocationChr07:32892724-32896714 (-)
DescriptionSimilar to ASY1: Meiosis-specific protein ASY1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
UniProt: F4HRV8 Required for normal meiosis in male and female gametophytes. No verified direct reference in this release
At4g32200 Required for normal meiosis. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0506800 Essential factor for meiotic homologous chromosome pairing (synapsis).
An insertional mutation in the rice PAIR2 gene, the ortholog of Arabidopsis ASY1, results in a defect in homologous chromosome pairing during meiosis.2004 · DOI: 10.1007/s00438-003-0934-z
PAIR2 is essential for homologous chromosome synapsis in rice meiosis I.2006 · DOI: 10.1242/jcs.02736
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032988 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0007129 homologous chromosome pairing at meiosis Biological Process
GO:0007130 synaptonemal complex assembly Biological Process
GO:0007283 spermatogenesis Biological Process
GO:0009554 megasporogenesis Biological Process
GO:0009556 microsporogenesis Biological Process
GO:0042138 meiotic DNA double-strand break formation Biological Process
GO:0051026 chiasma assembly Biological Process
GO:0051177 meiotic sister chromatid cohesion Biological Process
GO:0051321 meiotic cell cycle Biological Process
GO:0051598 meiotic recombination checkpoint signaling Biological Process
GO:0060629 regulation of homologous chromosome segregation Biological Process
GO:0000228 nuclear chromosome Cellular Component
KEGG gene cross-reference
ath:AT1G67370
ath:AT4G32200
dosa:Os09g0506800
rno:365868
xla:496240
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.885
Rank 1 · LXL04_032988 · OH-1004
Cytoplasm0.222
Rank 2 · LXL04_032988 · OH-1004
Mitochondrion0.032
Rank 3 · LXL04_032988 · OH-1004
Cell membrane0.030
Rank 4 · LXL04_032988 · OH-1004
Golgi apparatus0.017
Rank 5 · LXL04_032988 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02301.24HORMA33-235 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_032988PF02301.24HORMA332352.5e-62210.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4HRV8Arabidopsis thalianaMeiosis-specific protein ASY160.196%Swiss-Protstrong database homology
F4JTJ9Arabidopsis thalianaMeiosis-specific protein ASY252.448%Swiss-Protweak database homology
Q76CY8Oryza sativa subsp. japonicaMeiosis-specific protein PAIR252.572%Swiss-Protstrong database homology

JBrowse

View in Genome Browser