LXL04_032900 | RubberDandelionOmics

Gene overview

LXL04_032900

Reference: OH-1004 Chr: Chr07 Coordinates: 31398650-31401043 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · LXL04_032900|LXL04_032900|OH1004|cDNA

tttattattaaccTTAATCAATTCACTCAACTACTCTTTTTTCCTTCTGTCTTCTCCAAAACCCCCACCGATCGCCGTCGTCCTCTACCTCTCTCCGACATGGCGTCATCTACCCAACCTCCTTCGCAGAATGATGATAGTGATGAAGTCTTCCAGCTGGTCAAAGCTCATCAGGAGAAGGCTACTAGACTGCCTCCCATTGAGGAAATCAGGACTATCCTTGATCACAGCATTCGTGGCATGCTTTCCACTTTCTCTCA...

CDS

Download CDS FASTA

822 bp · LXL04_032900|LXL04_032900|OH1004|CDS

ATGGCGTCATCTACCCAACCTCCTTCGCAGAATGATGATAGTGATGAAGTCTTCCAGCTGGTCAAAGCTCATCAGGAGAAGGCTACTAGACTGCCTCCCATTGAGGAAATCAGGACTATCCTTGATCACAGCATTCGTGGCATGCTTTCCACTTTCTCTCAGAAGCATGAGAGTTATCCTTCTGGATCAATGGTTGATTTTGCATGTGATGCAAACGGATCTCCAATATTAGTAGTCAGTGATTTGGCAGCTCATACAAA...

Protein

Download Protein FASTA

273 aa · LXL04_032900|LXL04_032900|OH1004|PROTEIN

MASSTQPPSQNDDSDEVFQLVKAHQEKATRLPPIEEIRTILDHSIRGMLSTFSQKHESYPSGSMVDFACDANGSPILVVSDLAAHTKELLSNPKCSLLIAKDPDDRTDLIITLHGDAVSVPETEKEAIRASYLAKHPDALWVDFVDFRFLRIEPKVVSFVSGIATALLQSGEFTNKDFREAKVDQIYQFSKPISSHMNKDHSNDTKLIVQHSTSVPVDFAYMLDVDSLGFNVKAGYKNSNLKLRIPFPRPAEERKDVKAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032900`
TK1151 ID	TkA08G212490
OH-1004 ID	LXL04_032900
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 89.216 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032900

Location Chr07:31398650-31401043 (+)

Description Similar to GLUTRBP: Glutamyl-tRNA reductase-binding protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03890`	Dimeric beta-barrel protein binding to heme and catalyzing its degradation to produce biliverdin.	The Arabidopsis locus AT3G03890 encodes a dimeric β-barrel protein implicated in heme degradation.2020 · DOI: 10.1042/bcj20200712
`At3g21200`	Involved in the regulation of glutamyl-tRNA reductase (GluTR) which is important for the synthesis and distribution of 5-aminolevulinate, a precursor in heme and chlorophyll biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032900 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006783 heme biosynthetic process Biological Process

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0033014 tetrapyrrole biosynthetic process Biological Process

GO:0042167 heme catabolic process Biological Process

GO:0070455 positive regulation of heme biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0032991 protein-containing complex Cellular Component

KEGG gene cross-reference

ath:AT3G03890

ath:AT3G21200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.667

Rank 1 · LXL04_032900 · OH-1004

Nucleus0.352

Rank 2 · LXL04_032900 · OH-1004

Mitochondrion0.078

Rank 3 · LXL04_032900 · OH-1004

Endoplasmic reticulum0.074

Rank 4 · LXL04_032900 · OH-1004

Cell membrane0.074

Rank 5 · LXL04_032900 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01243.28PNPOx_N35-160 aa

PF13883.14CREG_beta-barrel38-161 aa

PF10615.15DUF2470190-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032900	`PF01243.28`	PNPOx_N	35	160	3.2e-12	47.6
LXL04_032900	`PF13883.14`	CREG_beta-barrel	38	161	4.3e-14	53.5
LXL04_032900	`PF10615.15`	DUF2470	190	264	1.3e-18	68.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LDU1`	Arabidopsis thaliana	Non-canonical heme oxygenase HOZ, chloroplastic	68.321%	Swiss-Prot	strong database homology
`Q9LU39`	Arabidopsis thaliana	Glutamyl-tRNA reductase-binding protein, chloroplastic	26.087%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card