LXL04_032831 | RubberDandelionOmics

Gene overview

LXL04_032831

Reference: OH-1004 Chr: Chr07 Coordinates: 30110250-30112010 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · LXL04_032831|LXL04_032831|OH1004|cDNA

ATGCTGGGCGGACTCATCACAACCACTCTTGTGTTAATTCTTGGATACGCATATCCAGCTTTCGAGTGTTTTAAAACCATCGAGAGACGTGGTACAGAAAACGCAGAATTAAGATTTTGGTGTCAATATTGGGTCCTGATCGCAATAATTACAGTTTTTGAAAGGTTCGCTGATATATTCGTTTCATGGGTACCAATGTATTACGAAGCGAAGTTAGCGCTGATTATCTACTTATGGTATCCAAAAACCAAGGGAACAGA...

CDS

Download CDS FASTA

726 bp · LXL04_032831|LXL04_032831|OH1004|CDS

ATGCTGGGCGGACTCATCACAACCACTCTTGTGTTAATTCTTGGATACGCATATCCAGCTTTCGAGTGTTTTAAAACCATCGAGAGACGTGGTACAGAAAACGCAGAATTAAGATTTTGGTGTCAATATTGGGTCCTGATCGCAATAATTACAGTTTTTGAAAGGTTCGCTGATATATTCGTTTCATGGGTACCAATGTATTACGAAGCGAAGTTAGCGCTGATTATCTACTTATGGTATCCAAAAACCAAGGGAACAGA...

Protein

Download Protein FASTA

241 aa · LXL04_032831|LXL04_032831|OH1004|PROTEIN

MLGGLITTTLVLILGYAYPAFECFKTIERRGTENAELRFWCQYWVLIAIITVFERFADIFVSWVPMYYEAKLALIIYLWYPKTKGTEYVYQTLLRPFLSRHETDIERHLDTMRARAWEVAIHYWNNSSELGQAKLFEIMQYIASQPMRPRSEVSRNVENTREGRPPPSPPPPAVAPTSTEAPQPDQAEDRWIPTAPPMPNISRRHPGNPGELDSPGSPNGSQLNPGEKEPVWLRFKRSQGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032831`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032831

Location Chr07:30110250-30112010 (-)

Description Similar to HVA22I: HVA22-like protein i

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42560`	HVA22-like protein i.	No verified direct reference in this release
`At2g36020`	HVA22-like protein j.	No verified direct reference in this release
`At1g75700`	Putative HVA22-like protein g.	No verified direct reference in this release
`At1g19950`	HVA22-like protein h.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032831 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006998 nuclear envelope organization Biological Process

GO:0007084 mitotic nuclear membrane reassembly Biological Process

GO:0051301 cell division Biological Process

GO:0071786 endoplasmic reticulum tubular network organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005881 cytoplasmic microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0071782 endoplasmic reticulum tubular network Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G19950

ath:AT1G75700

ath:AT2G36020

ath:AT5G42560

rno:306014

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.610

Rank 1 · LXL04_032831 · OH-1004

Nucleus0.193

Rank 2 · LXL04_032831 · OH-1004

Cytoplasm0.147

Rank 3 · LXL04_032831 · OH-1004

Golgi apparatus0.126

Rank 4 · LXL04_032831 · OH-1004

Cell membrane0.058

Rank 5 · LXL04_032831 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03134.25TB2_DP1_HVA2219-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032831	`PF03134.25`	TB2_DP1_HVA22	19	97	9.4e-27	93.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LE10`	Arabidopsis thaliana	HVA22-like protein i	52.273%	Swiss-Prot	strong database homology
`Q8GXE9`	Arabidopsis thaliana	HVA22-like protein j	48.634%	Swiss-Prot	moderate database homology
`Q9LR09`	Arabidopsis thaliana	Putative HVA22-like protein g	49.375%	Swiss-Prot	moderate database homology
`Q8LEM6`	Arabidopsis thaliana	HVA22-like protein h	36.325%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card