Gene Card
Gene overview
cDNA / CDS / Protein Sequences
618 bp · LXL04_032796|LXL04_032796|OH1004|cDNA
ATGCCTGTAATTCACAATTTTAGGTTGCCTAAGGAGAGAACTGTTGGAGATGTTCTAAATGATTTAACGACAAAGGTGGAATTGTCACATCCAAATGCTGAATTGAGACTACTCGAAGTATTCTATCATAAGATTTACAAGATATTTTCTCTAACAAAGAGAATAGAGGAAATAAATGACCAATACTGGACATTACGTGCTGAGGAAATTCCGGAAGAAGAGAAAGATCTTGGGCCCACAGATCGCTTGATTCATGTTTA...
618 bp · LXL04_032796|LXL04_032796|OH1004|CDS
ATGCCTGTAATTCACAATTTTAGGTTGCCTAAGGAGAGAACTGTTGGAGATGTTCTAAATGATTTAACGACAAAGGTGGAATTGTCACATCCAAATGCTGAATTGAGACTACTCGAAGTATTCTATCATAAGATTTACAAGATATTTTCTCTAACAAAGAGAATAGAGGAAATAAATGACCAATACTGGACATTACGTGCTGAGGAAATTCCGGAAGAAGAGAAAGATCTTGGGCCCACAGATCGCTTGATTCATGTTTA...
Protein
Download Protein FASTA205 aa · LXL04_032796|LXL04_032796|OH1004|PROTEIN
MPVIHNFRLPKERTVGDVLNDLTTKVELSHPNAELRLLEVFYHKIYKIFSLTKRIEEINDQYWTLRAEEIPEEEKDLGPTDRLIHVYHFTIKTAHNQTVLRKPKIRGGMTYPDPCPTVLQQLQNFGDPFFMKIRIHETLGDVKLRIQKKLQVPNDEFSKWKFAFVHLGQPEYLQDSDIVFSRFRRYDVYGGWEQYLGLEHPGTTQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032796 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032796 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:29403101-29404996 (+) | |||||||||
| Description | Similar to UBP12: Ubiquitin carboxyl-terminal hydrolase 12 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0006283 transcription-coupled nucleotide-excision repair Biological Process GO:0006307 DNA alkylation repair Biological Process GO:0006508 proteolysis Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:0010507 negative regulation of autophagy Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway Biological Process GO:0016579 protein deubiquitination Biological Process GO:0031453 positive regulation of heterochromatin formation Biological Process GO:0031647 regulation of protein stability Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G11910 ath:AT5G06600 dme:Dmel_CG1490 mmu:252870 rno:360471 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14533.13USP7_C25-94 aaPF14533.13USP7_C2123-204 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032796 | PF14533.13 | USP7_C2 | 5 | 94 | 4e-41 | 141.7 |
| LXL04_032796 | PF14533.13 | USP7_C2 | 123 | 204 | 4e-41 | 141.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.