Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1217 bp · LXL04_032788|LXL04_032788|OH1004|cDNA
AGGCAGGGTTGCCAACAAGATTCAAGCAATGGTGGGAAGGAATACCATTCCTTACTTCAATGGTGGTTGCAGTTTGTGCAGTGATTTACTTGGTTTCCCTTTTGTTTGGATACGACTCTTTCGCAGAAGTCTGCTTCTTGCCTTCTTCTGTTCTTTCAAAAGCTCAAGTTTACAGGATTTTCACATCTATATTCTTTCACGGATCAATACTTCATCTTGTTTTCAACATGTTAGCCCTAGTTCCTTTAGGCACAGAGTTG...
1209 bp · LXL04_032788|LXL04_032788|OH1004|CDS
TTGCCAACAAGATTCAAGCAATGGTGGGAAGGAATACCATTCCTTACTTCAATGGTGGTTGCAGTTTGTGCAGTGATTTACTTGGTTTCCCTTTTGTTTGGATACGACTCTTTCGCAGAAGTCTGCTTCTTGCCTTCTTCTGTTCTTTCAAAAGCTCAAGTTTACAGGATTTTCACATCTATATTCTTTCACGGATCAATACTTCATCTTGTTTTCAACATGTTAGCCCTAGTTCCTTTAGGCACAGAGTTGGAAAGAGT...
Protein
Download Protein FASTA402 aa · LXL04_032788|LXL04_032788|OH1004|PROTEIN
MPTRFKQWWEGIPFLTSMVVAVCAVIYLVSLLFGYDSFAEVCFLPSSVLSKAQVYRIFTSIFFHGSILHLVFNMLALVPLGTELERVMGSIRLLYMIVLLATTSAVFHLLITLIAAYNPIYSYYHFMNECAIGFSGVLFSMIVIETSLSGVQFRSVFGLFNVPAKLYPWILLVAFQLLMTNISLLGHLCGILSGFAYTYGLFNFLIPGSSFYSGIESSHWLSSCVRRPKYIMCTGGDPSGYIPTYTNRNTTSSETLSGNM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032788 |
|---|---|
| TK1151 ID | TkA08G204820 |
| OH-1004 ID | LXL04_032788 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 97.284 / OH-1004 98.010Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032788 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:29328969-29331366 (+) | |||||||||
| Description | Similar to RBL15: Rhomboid-like protein 15 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0010954 positive regulation of protein processing Biological Process GO:0030968 endoplasmic reticulum unfolded protein response Biological Process GO:0031293 membrane protein intracellular domain proteolysis Biological Process GO:0033619 membrane protein proteolysis Biological Process GO:0034620 cellular response to unfolded protein Biological Process GO:0034644 cellular response to UV Biological Process GO:0036503 ERAD pathway Biological Process GO:0043687 post-translational protein modification Biological Process GO:0045732 positive regulation of protein catabolic process Biological Process GO:0048515 spermatid differentiation Biological Process GO:0051047 positive regulation of secretion Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G17611 ath:AT3G58460 hsa:84236 mmu:76867 rno:316557 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04511.21DER112-199 aaPF08551.17DUF175119-197 aaPF01694.29Rhomboid52-203 aaPF00627.38UBA357-390 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032788 | PF04511.21 | DER1 | 12 | 199 | 9.1e-08 | 33.0 |
| LXL04_032788 | PF08551.17 | DUF1751 | 19 | 197 | 2.7e-06 | 27.6 |
| LXL04_032788 | PF01694.29 | Rhomboid | 52 | 203 | 1.4e-27 | 97.4 |
| LXL04_032788 | PF00627.38 | UBA | 357 | 390 | 1.5e-07 | 31.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.