LXL04_032774 | RubberDandelionOmics

Gene overview

LXL04_032774

Reference: OH-1004 Chr: Chr07 Coordinates: 29138318-29139901 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1584 bp · LXL04_032774|LXL04_032774|OH1004|cDNA

ATGGACAGGTTAATAACTTTAGAGCCATCCAATGTGGTTGCAATACGGATCGAACAAGGTCAAAGATGTTACGGTCAACTCACGTTAAGAAACGTCATGTACACAATGCCTGTAGCCTTCCGGTTACAACCGATGAACAAATCGCGGTACAGTATCCGTCCACAATCCGGGGTCATTTCACCACTGACAACTGTTACTATCGAAATCACATACGATTTCCCCCAAAATTCAACTCTCCCAGGGTCAATCCCGTACTCTGA...

CDS

Download CDS FASTA

1584 bp · LXL04_032774|LXL04_032774|OH1004|CDS

ATGGACAGGTTAATAACTTTAGAGCCATCCAATGTGGTTGCAATACGGATCGAACAAGGTCAAAGATGTTACGGTCAACTCACGTTAAGAAACGTCATGTACACAATGCCTGTAGCCTTCCGGTTACAACCGATGAACAAATCGCGGTACAGTATCCGTCCACAATCCGGGGTCATTTCACCACTGACAACTGTTACTATCGAAATCACATACGATTTCCCCCAAAATTCAACTCTCCCAGGGTCAATCCCGTACTCTGA...

Protein

Download Protein FASTA

527 aa · LXL04_032774|LXL04_032774|OH1004|PROTEIN

MDRLITLEPSNVVAIRIEQGQRCYGQLTLRNVMYTMPVAFRLQPMNKSRYSIRPQSGVISPLTTVTIEITYDFPQNSTLPGSIPYSDDSFLLHSVVVPGASATSTNDSVPSDWFTTRKKQVFVDSGIRVMFGGSIVMTRLVKNGAINEIREVLEKSDPSWNAINSVDSEGQTLLHLAVSQSRPDLVQLLLEFEPDIDGRNWSGASPLEAAAGSGQTLIVELLLAHRASMERLETSTWGAVHLAAGGGHVDVLKLLLLRGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032774`
TK1151 ID	TkA08G203880
OH-1004 ID	LXL04_032774
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 89.817 / OH-1004 86.338 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_032774`
Location	Chr07:29138318-29139901 (+)
Description	Similar to VPY: Protein VAPYRIN
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032774` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002237 response to molecule of bacterial origin Biological Process GO:0009609 response to symbiotic bacterium Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009877 nodulation Biological Process GO:0010247 detection of phosphate ion Biological Process GO:0010564 regulation of cell cycle process Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0071300 cellular response to retinoic acid Biological Process GO:0085020 protein K6-linked ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	hsa:255239 mtr:11415982 mtr:25495843 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.450

Rank 1 · LXL04_032774 · OH-1004

Nucleus0.317

Rank 2 · LXL04_032774 · OH-1004

Cell membrane0.127

Rank 3 · LXL04_032774 · OH-1004

Mitochondrion0.074

Rank 4 · LXL04_032774 · OH-1004

Golgi apparatus0.063

Rank 5 · LXL04_032774 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00635.33Motile_Sperm5-104 aa

PF12796.14Ank_2142-228 aa

PF13857.13Ank_5163-208 aa

PF13606.13Ank_3169-197 aa

PF13637.13Ank_4208-256 aa

PF12796.14Ank_2218-297 aa

PF00023.37Ank239-266 aa

PF13857.13Ank_5240-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032774	`PF00635.33`	Motile_Sperm	5	104	5e-08	33.5
LXL04_032774	`PF12796.14`	Ank_2	142	228	9.1e-61	203.2
LXL04_032774	`PF13857.13`	Ank_5	163	208	3.2e-42	142.8
LXL04_032774	`PF13606.13`	Ank_3	169	197	2.9e-45	147.2
LXL04_032774	`PF13637.13`	Ank_4	208	256	4.3e-45	151.4
LXL04_032774	`PF12796.14`	Ank_2	218	297	9.1e-61	203.2
LXL04_032774	`PF00023.37`	Ank	239	266	9.3e-56	183.3
LXL04_032774	`PF13857.13`	Ank_5	240	276	3.2e-42	142.8
LXL04_032774	`PF13637.13`	Ank_4	247	289	4.3e-45	151.4
LXL04_032774	`PF13857.13`	Ank_5	255	309	3.2e-42	142.8
LXL04_032774	`PF00023.37`	Ank	268	299	9.3e-56	183.3
LXL04_032774	`PF13637.13`	Ank_4	277	322	4.3e-45	151.4
LXL04_032774	`PF13857.13`	Ank_5	288	342	3.2e-42	142.8
LXL04_032774	`PF12796.14`	Ank_2	294	354	9.1e-61	203.2
LXL04_032774	`PF00023.37`	Ank	301	333	9.3e-56	183.3
LXL04_032774	`PF13606.13`	Ank_3	301	326	2.9e-45	147.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card