LXL04_032682 | RubberDandelionOmics

Gene overview

LXL04_032682

Reference: OH-1004 Chr: Chr07 Coordinates: 27774264-27776926 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1599 bp · LXL04_032682|LXL04_032682|OH1004|cDNA

ATGAAGGTATTGAAGACGGTGTCGGTTATGGATTTGGTAGCATGGAGATGGTTTGTGTCTGTTTTCATCCTCCAGTTCGTCTTCGCTCTTCAACCACTCGTTTACTCCCTAGATGGGAACACAGGGGATGCTGTTGAATTGTTTGAGAGAGCTTCGCGTAATATGGAAATGAAACGTTATGATGATGCAATTGATGATCTTAACGCTGCAATAGAAGCTGATCCGTTACTATCTGAAGCATACTGGAGTCGAGCTTTAGT...

CDS

Download CDS FASTA

1599 bp · LXL04_032682|LXL04_032682|OH1004|CDS

ATGAAGGTATTGAAGACGGTGTCGGTTATGGATTTGGTAGCATGGAGATGGTTTGTGTCTGTTTTCATCCTCCAGTTCGTCTTCGCTCTTCAACCACTCGTTTACTCCCTAGATGGGAACACAGGGGATGCTGTTGAATTGTTTGAGAGAGCTTCGCGTAATATGGAAATGAAACGTTATGATGATGCAATTGATGATCTTAACGCTGCAATAGAAGCTGATCCGTTACTATCTGAAGCATACTGGAGTCGAGCTTTAGT...

Protein

Download Protein FASTA

532 aa · LXL04_032682|LXL04_032682|OH1004|PROTEIN

MKVLKTVSVMDLVAWRWFVSVFILQFVFALQPLVYSLDGNTGDAVELFERASRNMEMKRYDDAIDDLNAAIEADPLLSEAYWSRALVLRHLCRYKESEESYKKFLQMKPQNSAVEKELSQLHQAQSALDTATNLFEHSDYTKALDFIDKVVLVFSPACSQAKILKAKLLLAAKDYSGVISESGYMLKEDEDNLEALLLRGRAYYYLADHDVATRHYQKGLRLDPEHTELKKSYFGLKNLLKKTKSAEDNEKKGKLRVAVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032682`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032682

Location Chr07:27774264-27776926 (-)

Description Similar to P58IPK: DnaJ protein P58IPK homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03160`	Plays an important positive role in viral symptom development and is required for viral multiplication and pathogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0977200`	May play a role in protein folding in the endoplasmic reticulum.	Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.2013 · DOI: 10.1093/jxb/ert312
`Os02g0195300`	May play a role in protein folding in the endoplasmic reticulum.	Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.2013 · DOI: 10.1093/jxb/ert312

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032682 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006986 response to unfolded protein Biological Process

GO:0034975 protein folding in endoplasmic reticulum Biological Process

GO:0036494 positive regulation of translation initiation in response to endoplasmic reticulum stress Biological Process

GO:0044794 host-mediated activation of viral process Biological Process

GO:0070417 cellular response to cold Biological Process

GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004860 protein kinase inhibitor activity Molecular Function

GO:0019901 protein kinase binding Molecular Function

GO:0051087 protein-folding chaperone binding Molecular Function

KEGG gene cross-reference

ath:AT5G03160

bta:286770

dosa:Os01g0977200

dosa:Os02g0195300

gga:418787

osa:4327812

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.313

Rank 1 · LXL04_032682 · OH-1004

Cytoplasm0.267

Rank 2 · LXL04_032682 · OH-1004

Mitochondrion0.166

Rank 3 · LXL04_032682 · OH-1004

Nucleus0.140

Rank 4 · LXL04_032682 · OH-1004

Peroxisome0.117

Rank 5 · LXL04_032682 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13432.13TPR_1651-111 aa

PF07719.24TPR_2194-226 aa

PF00226.37DnaJ365-428 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032682	`PF13432.13`	TPR_16	51	111	1.1e-15	58.4
LXL04_032682	`PF07719.24`	TPR_2	194	226	2.7e-26	90.2
LXL04_032682	`PF00226.37`	DnaJ	365	428	1.5e-26	93.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYW9`	Arabidopsis thaliana	DnaJ protein P58IPK homolog	68.653%	Swiss-Prot	strong database homology
`Q5JNB5`	Oryza sativa subsp. japonica	DnaJ protein P58IPK homolog B	66.588%	Swiss-Prot	strong database homology
`A0A0P0VG31`	Oryza sativa subsp. japonica	DnaJ protein P58IPK homolog A	63.341%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card