LXL04_032603 | RubberDandelionOmics

Gene overview

LXL04_032603

Reference: OH-1004 Chr: Chr07 Coordinates: 26146632-26148193 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · LXL04_032603|LXL04_032603|OH1004|cDNA

atgaacACCAAAAGAACCATATTCTTTTGGCTATCAGTCATCACCATTGCTCTTATTTCCATAATAATCTCTTTCTACAACTCAACCATAACTACTACCATCGTCTCTTTACCTGGCTTTCAAGTCGCTTTTATCAAAAGGGTCTTTGAGAAAAGTGGAATTTATGAGTTAGTCTCTTTCATAACCCAAATTTCCGGTCACCACCACCGCCTTCACGACCAGAAGGCTACCTGTTCCAACAAGTGGAGCTCAAGTCTTGT...

CDS

Download CDS FASTA

1209 bp · LXL04_032603|LXL04_032603|OH1004|CDS

ATGAACACCAAAAGAACCATATTCTTTTGGCTATCAGTCATCACCATTGCTCTTATTTCCATAATAATCTCTTTCTACAACTCAACCATAACTACTACCATCGTCTCTTTACCTGGCTTTCAAGTCGCTTTTATCAAAAGGGTCTTTGAGAAAAGTGGAATTTATGAGTTAGTCTCTTTCATAACCCAAATTTCCGGTCACCACCACCGCCTTCACGACCAGAAGGCTACCTGTTCCAACAAGTGGAGCTCAAGTCTTGT...

Protein

Download Protein FASTA

402 aa · LXL04_032603|LXL04_032603|OH1004|PROTEIN

MNTKRTIFFWLSVITIALISIIISFYNSTITTTIVSLPGFQVAFIKRVFEKSGIYELVSFITQISGHHHRLHDQKATCSNKWSSSLVSEYRVSLILTVDQNGCGNFTSLQEAVDAVPDSSSSSTLIILDSGTYREKVTVNENKTNLIIQGQGYLNTEITWNDTANSTGGTIYSSTISIFAQKFTAYNISFKNTAPPPILGAVGAQALALRIAGDQAAFYGCGFYGAQDTLHDDRGRHYFKKCFIEGSIDFVFGNGRSLYE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032603`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032603

Location Chr07:26146632-26148193 (+)

Description Similar to PME15: Probable pectinesterase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36710`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At2g36700`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At1g05310`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g19730`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g47500`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032603 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0030599 pectinesterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05310

ath:AT2G36700

ath:AT2G36710

ath:AT5G19730

ath:AT5G47500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.281

Rank 1 · LXL04_032603 · OH-1004

Extracellular0.222

Rank 2 · LXL04_032603 · OH-1004

Cell membrane0.143

Rank 3 · LXL04_032603 · OH-1004

Endoplasmic reticulum0.142

Rank 4 · LXL04_032603 · OH-1004

Cytoplasm0.115

Rank 5 · LXL04_032603 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01095.26Pectinesterase97-390 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032603	`PF01095.26`	Pectinesterase	97	390	1.4e-67	228.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQA3`	Arabidopsis thaliana	Probable pectinesterase 15	56.234%	Swiss-Prot	strong database homology
`Q9ZQA4`	Arabidopsis thaliana	Putative pectinesterase 14	55.490%	Swiss-Prot	strong database homology
`O23038`	Arabidopsis thaliana	Probable pectinesterase 8	55.116%	Swiss-Prot	strong database homology
`Q8VYZ3`	Arabidopsis thaliana	Probable pectinesterase 53	46.429%	Swiss-Prot	moderate database homology
`Q8LPF3`	Arabidopsis thaliana	Probable pectinesterase 68	45.562%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card