LXL04_032594 | RubberDandelionOmics

Gene overview

LXL04_032594

Reference: OH-1004 Chr: Chr07 Coordinates: 26040496-26045402 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1941 bp · LXL04_032594|LXL04_032594|OH1004|cDNA

ATGACGACcgcaccaccaccacctacgCCCTCGACGAACACGGCGCCACCGGCGTCGTTGTATGTAGGGGATTTGCATCGGCAGATCGACGAAACGCAACTAAACAATGTCTTTTCAGAGTACCCGAGCCTTTCTTCTGTACGAATTTGTAAAGACTCATCGACCACCCGCTCTCTCTGTTATGGATACGTTAACTTTACTTCTCCTCAAGACGCAGCTATTCGTGCTATCGAATCAAAAAACAACACCATGCTTTACGG...

CDS

Download CDS FASTA

1941 bp · LXL04_032594|LXL04_032594|OH1004|CDS

ATGACGACCGCACCACCACCACCTACGCCCTCGACGAACACGGCGCCACCGGCGTCGTTGTATGTAGGGGATTTGCATCGGCAGATCGACGAAACGCAACTAAACAATGTCTTTTCAGAGTACCCGAGCCTTTCTTCTGTACGAATTTGTAAAGACTCATCGACCACCCGCTCTCTCTGTTATGGATACGTTAACTTTACTTCTCCTCAAGACGCAGCTATTCGTGCTATCGAATCAAAAAACAACACCATGCTTTACGG...

Protein

Download Protein FASTA

646 aa · LXL04_032594|LXL04_032594|OH1004|PROTEIN

MTTAPPPPTPSTNTAPPASLYVGDLHRQIDETQLNNVFSEYPSLSSVRICKDSSTTRSLCYGYVNFTSPQDAAIRAIESKNNTMLYGKMIRVTWSHRDPDVRRSGIGNVFVKNLNDSIDNVQLQELFKAFGNILSCKVVTHEDGKSKGYGFVQFDSLESANSAIEKLNGTNVGGKLIYVGKFMKKSDRILPSPDAKYTNLYIKNLDMDISEEILDQTFSKFGKIVSLVISRDNNGVSRGFGFVNFENPDDARKAVEDLNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032594`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032594

Location Chr07:26040496-26045402 (-)

Description Similar to PAB7: Polyadenylate-binding protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36660`	Binds the poly(A) tail of mRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032594 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006417 regulation of translation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0045070 positive regulation of viral genome replication Biological Process

GO:0048255 mRNA stabilization Biological Process

GO:0060213 positive regulation of nuclear-transcribed mRNA poly(A) tail shortening Biological Process

GO:0070934 CRD-mediated mRNA stabilization Biological Process

GO:1900152 negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process

GO:1900153 positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process

KEGG gene cross-reference

ath:AT2G36660

bta:282296

hsa:26986

mmu:18458

rno:171350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.608

Rank 1 · LXL04_032594 · OH-1004

Nucleus0.441

Rank 2 · LXL04_032594 · OH-1004

Cell membrane0.057

Rank 3 · LXL04_032594 · OH-1004

Mitochondrion0.043

Rank 4 · LXL04_032594 · OH-1004

Endoplasmic reticulum0.038

Rank 5 · LXL04_032594 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_120-90 aa

PF00076.29RRM_1109-177 aa

PF00076.29RRM_1200-268 aa

PF00076.29RRM_1303-371 aa

PF00658.25MLLE552-617 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032594	`PF00076.29`	RRM_1	20	90	9.6e-85	279.2
LXL04_032594	`PF00076.29`	RRM_1	109	177	9.6e-85	279.2
LXL04_032594	`PF00076.29`	RRM_1	200	268	9.6e-85	279.2
LXL04_032594	`PF00076.29`	RRM_1	303	371	9.6e-85	279.2
LXL04_032594	`PF00658.25`	MLLE	552	617	7.5e-30	103.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQA8`	Arabidopsis thaliana	Polyadenylate-binding protein 7	51.115%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card