LXL04_032537 | RubberDandelionOmics

Gene overview

LXL04_032537

Reference: OH-1004 Chr: Chr07 Coordinates: 24857313-24859752 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · LXL04_032537|LXL04_032537|OH1004|cDNA

ATGGCAGATCCTCCAAATCATTTCTTCAAGTTCGTCCTTCCAGGCTTTTTATTCAACCTTTCGATTCCAAGTTATTTTTTGACAAATCTGAACGTCAAGATATGCTCGAAACTAATACTGAGACGTGGGCGTCACGAATGGTCTGTAGATATTGACGACGGGGTCTTTGGCGACGGTTGGAGGAGATTTGTGAAAGAGAATGGAGTGCAAGAGTTTGACTTTATTGTGTTCAAACATCATGGAAGCATGGTGTTTGACTT...

CDS

Download CDS FASTA

744 bp · LXL04_032537|LXL04_032537|OH1004|CDS

ATGGCAGATCCTCCAAATCATTTCTTCAAGTTCGTCCTTCCAGGCTTTTTATTCAACCTTTCGATTCCAAGTTATTTTTTGACAAATCTGAACGTCAAGATATGCTCGAAACTAATACTGAGACGTGGGCGTCACGAATGGTCTGTAGATATTGACGACGGGGTCTTTGGCGACGGTTGGAGGAGATTTGTGAAAGAGAATGGAGTGCAAGAGTTTGACTTTATTGTGTTCAAACATCATGGAAGCATGGTGTTTGACTT...

Protein

Download Protein FASTA

247 aa · LXL04_032537|LXL04_032537|OH1004|PROTEIN

MADPPNHFFKFVLPGFLFNLSIPSYFLTNLNVKICSKLILRRGRHEWSVDIDDGVFGDGWRRFVKENGVQEFDFIVFKHHGSMVFDFSVFDQSTCERQYPTLLDAPIESDTVHTEGLKCFEKRKMNEFASQDQKKFQVKKETGSSMKKKSSLTTNNYEYFISNLTPSNFTKTALIKKKKKFRRIDRGNIPVGNRCSLGWKAGEAELREVAGNRCSLGWIWTPEEGAVAVRIWTVGIAAKMLWGIAVR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032537`
TK1151 ID	TkA07G374480
OH-1004 ID	LXL04_032537
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.800
Protein coverage (%)	TK1151 28.866 / OH-1004 26.316 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032537

Location Chr07:24857313-24859752 (+)

Description Similar to REM9: B3 domain-containing protein REM9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31690`	B3 domain-containing protein REM9.	No verified direct reference in this release
`At4g31680`	B3 domain-containing protein REM8.	No verified direct reference in this release
`At4g31640`	B3 domain-containing protein REM5.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0622200`	B3 domain-containing protein Os03g0622200.	No verified direct reference in this release
`Os03g0622100`	B3 domain-containing protein Os03g0622100.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032537 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G31640

ath:AT4G31680

ath:AT4G31690

dosa:Os03g0622100

dosa:Os03g0622200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · LXL04_032537 · OH-1004

Cytoplasm0.092

Rank 2 · LXL04_032537 · OH-1004

Cell membrane0.033

Rank 3 · LXL04_032537 · OH-1004

Endoplasmic reticulum0.021

Rank 4 · LXL04_032537 · OH-1004

Plastid0.010

Rank 5 · LXL04_032537 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362.27B318-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032537	`PF02362.27`	B3	18	91	3.2e-09	37.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81778`	Arabidopsis thaliana	B3 domain-containing protein REM9	38.235%	Swiss-Prot	weak database homology
`Q8H2D1`	Arabidopsis thaliana	B3 domain-containing protein REM8	38.235%	Swiss-Prot	weak database homology
`Q9SB80`	Arabidopsis thaliana	B3 domain-containing protein REM5	34.021%	Swiss-Prot	weak database homology
`Q10GM3`	Oryza sativa subsp. japonica	B3 domain-containing protein Os03g0622200	33.036%	Swiss-Prot	weak database homology
`Q10GM4`	Oryza sativa subsp. japonica	B3 domain-containing protein Os03g0622100	33.636%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card