LXL04_032535 | RubberDandelionOmics

Gene overview

LXL04_032535

Reference: OH-1004 Chr: Chr07 Coordinates: 24847887-24853433 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1662 bp · LXL04_032535|LXL04_032535|OH1004|cDNA

ATGGAAGCAGAACCAAAACCATCTGGTTCACCCACCAAAGGTGGCTGGATCACCTTCCCTTTCCTCATAGCAACCATGGCTGGTTTGACACTAGCCGCCGGAGGATGGGCGAATAATATTATCGTATATCTAATCAACGAGTTCCACATCAAAAGCATCGATGCTGCTCAAATTGCAAACATAGTCAACGGTTGCACCGCACTGTTCCCAATCCTAGGAGCCATACTCGCTGACTCGTTTTTTGGCTCGTTCGCAGTCAT...

CDS

Download CDS FASTA

1662 bp · LXL04_032535|LXL04_032535|OH1004|CDS

ATGGAAGCAGAACCAAAACCATCTGGTTCACCCACCAAAGGTGGCTGGATCACCTTCCCTTTCCTCATAGCAACCATGGCTGGTTTGACACTAGCCGCCGGAGGATGGGCGAATAATATTATCGTATATCTAATCAACGAGTTCCACATCAAAAGCATCGATGCTGCTCAAATTGCAAACATAGTCAACGGTTGCACCGCACTGTTCCCAATCCTAGGAGCCATACTCGCTGACTCGTTTTTTGGCTCGTTCGCAGTCAT...

Protein

Download Protein FASTA

553 aa · LXL04_032535|LXL04_032535|OH1004|PROTEIN

MEAEPKPSGSPTKGGWITFPFLIATMAGLTLAAGGWANNIIVYLINEFHIKSIDAAQIANIVNGCTALFPILGAILADSFFGSFAVISVSSFISLVGILLLTLTATLDPLKPAICENRSTLCMAPSKIQLAVLYASLALSSVGLAGTRFTLATMGADQFDKPKDQGVFFNWHFFTMYAGTLVSVVGIIYVEDNVSWGLGFGLCVAANLIGLVVFVVGRRKYRLLKPQGSPFTGLACVVVAAFRKRKVLLSLKGEDYWQEP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032535`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032535

Location Chr07:24847887-24853433 (+)

Description Similar to NPF2.7: Protein NRT1/ PTR FAMILY 2.7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45650`	Transporter involved in a passive nitrate efflux.	Nitrate efflux at the root plasma membrane: identification of an Arabidopsis excretion transporter.2007 · DOI: 10.1105/tpc.106.048173
`At3g45700`	Transporter involved in a passive nitrate efflux.	No verified direct reference in this release
`At3g45660`	Transporter involved in a passive nitrate efflux.	No verified direct reference in this release
`At3g45680`	Transporter involved in a passive nitrate efflux.	No verified direct reference in this release
`At3g45710`	Transporter involved in a passive nitrate efflux.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032535 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006821 chloride transport Biological Process

GO:0006857 oligopeptide transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0010447 response to acidic pH Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:1902075 cellular response to salt Biological Process

GO:1902476 chloride transmembrane transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G45650

ath:AT3G45660

ath:AT3G45680

ath:AT3G45700

ath:AT3G45710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.779

Rank 1 · LXL04_032535 · OH-1004

Lysosome / Vacuole0.078

Rank 2 · LXL04_032535 · OH-1004

Endoplasmic reticulum0.075

Rank 3 · LXL04_032535 · OH-1004

Cytoplasm0.064

Rank 4 · LXL04_032535 · OH-1004

Golgi apparatus0.026

Rank 5 · LXL04_032535 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690.22MFS_130-489 aa

PF00854.28PTR284-500 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032535	`PF07690.22`	MFS_1	30	489	2.1e-11	44.1
LXL04_032535	`PF00854.28`	PTR2	84	500	1.9e-67	228.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1E2`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.7	55.805%	Swiss-Prot	strong database homology
`Q9M173`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.4	52.855%	Swiss-Prot	strong database homology
`Q9M1E1`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.6	53.860%	Swiss-Prot	strong database homology
`Q9M175`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.3	51.277%	Swiss-Prot	strong database homology
`Q9M172`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.5	52.230%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card