LXL04_032506 | RubberDandelionOmics

Gene overview

LXL04_032506

Reference: OH-1004 Chr: Chr07 Coordinates: 24203250-24206197 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1335 bp · LXL04_032506|LXL04_032506|OH1004|cDNA

ATGACGGAAATCGTAGGGCAGAAATGGAAGATCATGAGATTTGTGACGATGATGCTGGTGAACTTTCTGTTCGCTTCAATGCTCGTTTCGGCGGAAAGAAGCGTAATGATGGAAGACGTAGCCGGAGTTGTAAGCTATGGCGATGATGATGAATCAGAAATGGGGTATTTTTTGAAGTTGACGAACTATTTGTTTCAAACAGATGGATCGGGTTATCACCATGTCTGGCCTGAAATGGAACTTGGTTGGAAAATAGTTCT...

CDS

Download CDS FASTA

1335 bp · LXL04_032506|LXL04_032506|OH1004|CDS

ATGACGGAAATCGTAGGGCAGAAATGGAAGATCATGAGATTTGTGACGATGATGCTGGTGAACTTTCTGTTCGCTTCAATGCTCGTTTCGGCGGAAAGAAGCGTAATGATGGAAGACGTAGCCGGAGTTGTAAGCTATGGCGATGATGATGAATCAGAAATGGGGTATTTTTTGAAGTTGACGAACTATTTGTTTCAAACAGATGGATCGGGTTATCACCATGTCTGGCCTGAAATGGAACTTGGTTGGAAAATAGTTCT...

Protein

Download Protein FASTA

444 aa · LXL04_032506|LXL04_032506|OH1004|PROTEIN

MTEIVGQKWKIMRFVTMMLVNFLFASMLVSAERSVMMEDVAGVVSYGDDDESEMGYFLKLTNYLFQTDGSGYHHVWPEMELGWKIVLGSFIGFCGAAFGSVGGVGGGGIFVPMLTLIIGFDPKSATAISKCMIMGAAASTVYYNLKLRHPTLDMPIIDYDLALLIQPMLMLGISIGVAFNVIFADWMVTVLLIILFIGTSSKAFCRGVDTWKKETIMKKVSLFENVCWKELALLVFVWISFLALQIAKNYTSNCSTWYWT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032506`
TK1151 ID	TkA08G182190
OH-1004 ID	LXL04_032506
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032506

Location Chr07:24203250-24206197 (-)

Description Similar to At2g25737: Sulfite exporter TauE/SafE family protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25737`	Sulfite exporter TauE/SafE family protein 3.	No verified direct reference in this release
`At2g36630`	Sulfite exporter TauE/SafE family protein 4.	No verified direct reference in this release
`At1g61740`	Sulfite exporter TauE/SafE family protein 2.	No verified direct reference in this release
`At1g11540`	Sulfite exporter TauE/SafE family protein 1.	No verified direct reference in this release
`At4g21260`	Sulfite exporter TauE/SafE family protein 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032506 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031464 Cul4A-RING E3 ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT1G11540

ath:AT1G61740

ath:AT2G25737

ath:AT2G36630

ath:AT4G21260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.479

Rank 1 · LXL04_032506 · OH-1004

Cell membrane0.270

Rank 2 · LXL04_032506 · OH-1004

Cytoplasm0.113

Rank 3 · LXL04_032506 · OH-1004

Golgi apparatus0.110

Rank 4 · LXL04_032506 · OH-1004

Endoplasmic reticulum0.107

Rank 5 · LXL04_032506 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01925.26TauE90-200 aa

PF01925.26TauE306-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032506	`PF01925.26`	TauE	90	200	3.6e-23	83.2
LXL04_032506	`PF01925.26`	TauE	306	411	3.6e-23	83.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7A0`	Arabidopsis thaliana	Sulfite exporter TauE/SafE family protein 3	67.585%	Swiss-Prot	strong database homology
`Q8S9J0`	Arabidopsis thaliana	Sulfite exporter TauE/SafE family protein 4	47.917%	Swiss-Prot	moderate database homology
`Q9SYB0`	Arabidopsis thaliana	Sulfite exporter TauE/SafE family protein 2	28.362%	Swiss-Prot	weak database homology
`F4I8X6`	Arabidopsis thaliana	Sulfite exporter TauE/SafE family protein 1	30.108%	Swiss-Prot	moderate database homology
`O49567`	Arabidopsis thaliana	Sulfite exporter TauE/SafE family protein 6	28.846%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card