LXL04_032488 | RubberDandelionOmics

Gene overview

LXL04_032488

Reference: OH-1004 Chr: Chr07 Coordinates: 24039249-24042057 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1743 bp · LXL04_032488|LXL04_032488|OH1004|cDNA

ATGGAAGAAATACCGATGAATGAAAAGTCGAGCATCGATGCAGAATTACAAACGAAATTAATCCTGCACAGTGATCATGATCGTAAAGGTGGTCTCAGAACCATGCCGTTCATCATAGTGAATGAAGCATTTGAGAGAGTGGCGAGCTATGGACTGATGCCAAACATGATATTCTATCTGATGGAAGTTTATCACATGGAAGCTGTAACTGGAACAAGCATACTCTCCATCTGGTCAGCTCTTTCGAACGGTCTCTCCAT...

CDS

Download CDS FASTA

1743 bp · LXL04_032488|LXL04_032488|OH1004|CDS

ATGGAAGAAATACCGATGAATGAAAAGTCGAGCATCGATGCAGAATTACAAACGAAATTAATCCTGCACAGTGATCATGATCGTAAAGGTGGTCTCAGAACCATGCCGTTCATCATAGTGAATGAAGCATTTGAGAGAGTGGCGAGCTATGGACTGATGCCAAACATGATATTCTATCTGATGGAAGTTTATCACATGGAAGCTGTAACTGGAACAAGCATACTCTCCATCTGGTCAGCTCTTTCGAACGGTCTCTCCAT...

Protein

Download Protein FASTA

580 aa · LXL04_032488|LXL04_032488|OH1004|PROTEIN

MEEIPMNEKSSIDAELQTKLILHSDHDRKGGLRTMPFIIVNEAFERVASYGLMPNMIFYLMEVYHMEAVTGTSILSIWSALSNGLSIFGALIADSYLGRFWVIALGSLSTLLVSLPPPLSISILNKLTNIFLFLQGMISLWLTSMFPQLRPSSCSQLDAICTPATSTQLALLFSSLGLLSIGCGCIRPCSMAFGADQLNNDRTPNKQRVIDSYFNWYYASAAFSTVIAFTVVVYIQDRYGWQVGFAVPVLFMVCSALMFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032488`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032488

Location Chr07:24039249-24042057 (-)

Description Similar to NPF1.2: Protein NRT1/ PTR FAMILY 1.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52190`	Low-affinity nitrate transporter involved in xylem-to-phloem transfer for redistributing nitrate into developing leaves.	Two phloem nitrate transporters, NRT1.11 and NRT1.12, are important for redistributing xylem-borne nitrate to enhance plant growth.2013 · DOI: 10.1104/pp.113.226563
`At3g16180`	Low-affinity nitrate transporter involved in xylem-to-phloem transfer for redistributing nitrate into developing leaves.	No verified direct reference in this release
`At1g69870`	Low-affinity proton-dependent nitrate transporter.	The Arabidopsis nitrate transporter NRT1.7, expressed in phloem, is responsible for source-to-sink remobilization of nitrate.2009 · DOI: 10.1105/tpc.109.067603
`At5g62680`	High-affinity, proton-dependent glucosinolate-specific transporter.	NRT/PTR transporters are essential for translocation of glucosinolate defence compounds to seeds.2012 · DOI: 10.1038/nature11285 Integration of biosynthesis and long-distance transport establish organ-specific glucosinolate profiles in vegetative Arabidopsis.2013 · DOI: 10.1105/tpc.113.110890
`At1g18880`	Low-affinity nitrate transporter facilitating nitrate loading into root phloem.	Arabidopsis nitrate transporter NRT1.9 is important in phloem nitrate transport.2011 · DOI: 10.1105/tpc.111.083618

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032488 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010233 phloem transport Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0090408 phloem nitrate loading Biological Process

GO:0090449 phloem glucosinolate loading Biological Process

GO:1901349 glucosinolate transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015112 nitrate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G18880

ath:AT1G52190

ath:AT1G69870

ath:AT3G16180

ath:AT5G62680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.560

Rank 1 · LXL04_032488 · OH-1004

Lysosome / Vacuole0.187

Rank 2 · LXL04_032488 · OH-1004

Endoplasmic reticulum0.120

Rank 3 · LXL04_032488 · OH-1004

Cytoplasm0.077

Rank 4 · LXL04_032488 · OH-1004

Golgi apparatus0.045

Rank 5 · LXL04_032488 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854.28PTR2134-539 aa

PF07690.22MFS_1167-519 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032488	`PF00854.28`	PTR2	134	539	1.4e-73	248.8
LXL04_032488	`PF07690.22`	MFS_1	167	519	8.1e-13	48.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M817`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 1.2	45.085%	Swiss-Prot	moderate database homology
`Q8LPL2`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 1.1	44.662%	Swiss-Prot	moderate database homology
`Q8RX77`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.13	37.676%	Swiss-Prot	moderate database homology
`Q9LV10`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.11	35.314%	Swiss-Prot	moderate database homology
`Q9M9V7`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.9	34.118%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card