LXL04_032478 | RubberDandelionOmics

Gene overview

LXL04_032478

Reference: OH-1004 Chr: Chr07 Coordinates: 23894566-23898648 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1866 bp · LXL04_032478|LXL04_032478|OH1004|cDNA

ATGGATCGTCTTCTTTACCAGACTGTCCTAAAAGGCGACCACGTCACTTTCCTCAAACTCATTCAAGAAAACGAAACCCTAATCACACAGACCGTGGTTGGATCATCAAACACCGTCTTGCACTTAGCAGCTCGGTTAGGCCACCTGGAACTGGTGTCGGAGATATTGAAGGTCTGCCCAGATATGGTTGCGGCCGAGAACTGTGACCTAGAGACGCCGTTGCATGAAGCATGCAGAGAAGGAAAGTTTGAGGTGGTGAA...

CDS

Download CDS FASTA

1866 bp · LXL04_032478|LXL04_032478|OH1004|CDS

ATGGATCGTCTTCTTTACCAGACTGTCCTAAAAGGCGACCACGTCACTTTCCTCAAACTCATTCAAGAAAACGAAACCCTAATCACACAGACCGTGGTTGGATCATCAAACACCGTCTTGCACTTAGCAGCTCGGTTAGGCCACCTGGAACTGGTGTCGGAGATATTGAAGGTCTGCCCAGATATGGTTGCGGCCGAGAACTGTGACCTAGAGACGCCGTTGCATGAAGCATGCAGAGAAGGAAAGTTTGAGGTGGTGAA...

Protein

Download Protein FASTA

621 aa · LXL04_032478|LXL04_032478|OH1004|PROTEIN

MDRLLYQTVLKGDHVTFLKLIQENETLITQTVVGSSNTVLHLAARLGHLELVSEILKVCPDMVAAENCDLETPLHEACREGKFEVVKVLMAADEGVVGKVNSRGESVLFAACERGKIDVVKHLIEFEWLLLHEIDAFMCSIHVAAAGGHTDIVKEILNVRPEFARKYNSEGYSALHLACIKGQLDTTRELLWWDPDLVYLRDHNGWTPLHWASMKGRVGIIGEIISINLESIELVTNHGETVLHLAVKYNQFEVLKHLKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032478`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032478

Location Chr07:23894566-23898648 (+)

Description Similar to At5g02620: Ankyrin repeat-containing protein At5g02620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02620`	Ankyrin repeat-containing protein At5g02620.	No verified direct reference in this release
`At2g01680`	Ankyrin repeat-containing protein At2g01680.	No verified direct reference in this release
`At3g12360`	Involved in salt stress tolerance.	ITN1, a novel gene encoding an ankyrin-repeat protein that affects the ABA-mediated production of reactive oxygen species and is involved in salt-stress tolerance in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03614.x
`At5g54610`	Involved in plant defense.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0837000`	Involved in salt stress tolerance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032478 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G01680

ath:AT5G02620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.834

Rank 1 · LXL04_032478 · OH-1004

Endoplasmic reticulum0.092

Rank 2 · LXL04_032478 · OH-1004

Cytoplasm0.086

Rank 3 · LXL04_032478 · OH-1004

Nucleus0.061

Rank 4 · LXL04_032478 · OH-1004

Lysosome / Vacuole0.034

Rank 5 · LXL04_032478 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_29-91 aa

PF24521.3Ank_KRIT136-125 aa

PF12796.14Ank_2108-191 aa

PF13637.13Ank_4141-186 aa

PF12796.14Ank_2201-259 aa

PF12796.14Ank_2268-337 aa

PF13857.13Ank_5268-314 aa

PF00023.37Ank274-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032478	`PF12796.14`	Ank_2	9	91	2e-43	147.6
LXL04_032478	`PF24521.3`	Ank_KRIT1	36	125	1.7e-08	35.0
LXL04_032478	`PF12796.14`	Ank_2	108	191	2e-43	147.6
LXL04_032478	`PF13637.13`	Ank_4	141	186	2.3e-30	104.7
LXL04_032478	`PF12796.14`	Ank_2	201	259	2e-43	147.6
LXL04_032478	`PF12796.14`	Ank_2	268	337	2e-43	147.6
LXL04_032478	`PF13857.13`	Ank_5	268	314	1.8e-28	99.0
LXL04_032478	`PF00023.37`	Ank	274	305	7e-41	136.6
LXL04_032478	`PF13962.12`	PGG	393	499	9.7e-30	103.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AWW5`	Arabidopsis thaliana	Ankyrin repeat-containing protein At5g02620	30.444%	Swiss-Prot	moderate database homology
`Q9ZU96`	Arabidopsis thaliana	Ankyrin repeat-containing protein At2g01680	29.103%	Swiss-Prot	weak database homology
`Q9C7A2`	Arabidopsis thaliana	Ankyrin repeat-containing protein ITN1	28.729%	Swiss-Prot	weak database homology
`Q8GYH5`	Arabidopsis thaliana	Ankyrin repeat-containing protein BDA1	29.231%	Swiss-Prot	weak database homology
`A2CIR5`	Oryza sativa subsp. japonica	Ankyrin repeat-containing protein NPR4	30.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card