LXL04_032447 | RubberDandelionOmics

Gene overview

LXL04_032447

Reference: OH-1004 Chr: Chr07 Coordinates: 23156176-23156962 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

678 bp · LXL04_032447|LXL04_032447|OH1004|cDNA

ATggcgatgatgatgatgagaaTAGTCGATTCTACTTCCACCCCTTTATCTCGAATCTTCCCACCGTCAATACTCAATCGCAGCAATCTCTTCACTACCCATTTGAAATCGAGTCGAGATTTGTACAAGAAAATCGTCAATTTTGCCGGAATAAGGTTTGGGTCTGTTACCCGGGTTCCATATCGAAGTAACAGAGGGTTTAGAAGCGGAATTGTGGCTACGCCAGGTTCGGATGCCGTTCAGAAATCGGAGGACGAGTG...

CDS

Download CDS FASTA

678 bp · LXL04_032447|LXL04_032447|OH1004|CDS

ATGGCGATGATGATGATGAGAATAGTCGATTCTACTTCCACCCCTTTATCTCGAATCTTCCCACCGTCAATACTCAATCGCAGCAATCTCTTCACTACCCATTTGAAATCGAGTCGAGATTTGTACAAGAAAATCGTCAATTTTGCCGGAATAAGGTTTGGGTCTGTTACCCGGGTTCCATATCGAAGTAACAGAGGGTTTAGAAGCGGAATTGTGGCTACGCCAGGTTCGGATGCCGTTCAGAAATCGGAGGACGAGTG...

Protein

Download Protein FASTA

225 aa · LXL04_032447|LXL04_032447|OH1004|PROTEIN

MAMMMMRIVDSTSTPLSRIFPPSILNRSNLFTTHLKSSRDLYKKIVNFAGIRFGSVTRVPYRSNRGFRSGIVATPGSDAVQKSEDEWRAVLSPEQFRILREKGTEYPGTGQYNKFYEEGSLFFLQRAWVADEVEGGFGVGMLWWVGGGCRLEEGGVAGDGGNLIDATSLRVALTETMMKRRSEGNRFLYTDSCIRALNVKFPRHMSICPGVALTISSQCTHQEFN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032447`
TK1151 ID	TkA08G176360
OH-1004 ID	LXL04_032447
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 53.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032447

Location Chr07:23156176-23156962 (+)

Description Similar to MSRB2: Peptide methionine sulfoxide reductase B2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21860`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	The Arabidopsis plastidic methionine sulfoxide reductase B proteins. Sequence and activity characteristics, comparison of the expression with plastidic methionine sulfoxide reductase A, and induction by photooxidative stress.2005 · DOI: 10.1104/pp.105.062430 Specificity of thioredoxins and glutaredoxins as electron donors to two distinct classes of Arabidopsis plastidial methionine sulfoxide reductases B.2007 · DOI: 10.1016/j.febslet.2007.07.081 Regeneration mechanisms of Arabidopsis thaliana methionine sulfoxide reductases B by glutaredoxins and thioredoxins.2009 · DOI: 10.1074/jbc.m109.015487 Arabidopsis thaliana plastidial methionine sulfoxide reductases B, MSRBs, account for most leaf peptide MSR activity and are essential for growth under environmental constraints through a role in the preservation of photosystem antennae.2010 · DOI: 10.1111/j.1365-313x.2009.04053.x
`At4g04830`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	No verified direct reference in this release
`At4g04800`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	Role of the methionine sulfoxide reductase MsrB3 in cold acclimation in Arabidopsis.2007 · DOI: 10.1093/pcp/pcm143
`At4g04810`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0360700`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032447 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009631 cold acclimation Biological Process

GO:0030091 protein repair Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0033743 peptide-methionine (R)-S-oxide reductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G04800

ath:AT4G04810

ath:AT4G04830

ath:AT4G21860

dosa:Os03g0360700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.804

Rank 1 · LXL04_032447 · OH-1004

Nucleus0.103

Rank 2 · LXL04_032447 · OH-1004

Mitochondrion0.100

Rank 3 · LXL04_032447 · OH-1004

Cytoplasm0.034

Rank 4 · LXL04_032447 · OH-1004

Cell membrane0.020

Rank 5 · LXL04_032447 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5C8`	Arabidopsis thaliana	Peptide methionine sulfoxide reductase B2, chloroplastic	63.793%	Swiss-Prot	weak database homology
`Q9ZS91`	Arabidopsis thaliana	Peptide methionine sulfoxide reductase B5	82.500%	Swiss-Prot	weak database homology
`Q9M0Z6`	Arabidopsis thaliana	Peptide methionine sulfoxide reductase B3	70.833%	Swiss-Prot	weak database homology
`Q9M0Z5`	Arabidopsis thaliana	Peptide methionine sulfoxide reductase B4	77.500%	Swiss-Prot	weak database homology
`Q10L32`	Oryza sativa subsp. japonica	Peptide methionine sulfoxide reductase B5	74.419%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card