LXL04_032421 | RubberDandelionOmics

Gene overview

LXL04_032421

Reference: OH-1004 Chr: Chr07 Coordinates: 22504488-22508385 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2559 bp · LXL04_032421|LXL04_032421|OH1004|cDNA

ATGGAACCTGCAGTCCCAGTACTTGTTGGTTCAGAGATCCATGGCTTCAAAACAATGGAAGATTTGGATGTGCCCAATATGATGGAGGAAGCAAAGACAAGATGGCTCCGCCCAAATGAGATTCATGCAGTACTTTATAACCACAAGCATTTCAGCATCAGTGTGAAGCCACTTAATTTACCTCCAAGTGGCACTATTGTTCTATTTGACCGAAAGATGCTCAGAAATTTCCGGAAAGATGGGCATAACtggaaaaagaa...

CDS

Download CDS FASTA

2559 bp · LXL04_032421|LXL04_032421|OH1004|CDS

ATGGAACCTGCAGTCCCAGTACTTGTTGGTTCAGAGATCCATGGCTTCAAAACAATGGAAGATTTGGATGTGCCCAATATGATGGAGGAAGCAAAGACAAGATGGCTCCGCCCAAATGAGATTCATGCAGTACTTTATAACCACAAGCATTTCAGCATCAGTGTGAAGCCACTTAATTTACCTCCAAGTGGCACTATTGTTCTATTTGACCGAAAGATGCTCAGAAATTTCCGGAAAGATGGGCATAACTGGAAAAAGAA...

Protein

Download Protein FASTA

852 aa · LXL04_032421|LXL04_032421|OH1004|PROTEIN

MEPAVPVLVGSEIHGFKTMEDLDVPNMMEEAKTRWLRPNEIHAVLYNHKHFSISVKPLNLPPSGTIVLFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNNERIHVYYAHGEDRSTFVRRCYWLLDKKLEHIVLVHYRDTQELQGSPGLTVDSNSSSDPHTSSNLSEEIDGVDQVYFTEPNETVINHEMRLHEINTLEWDELVIPTGGNVAQFDQNTLNGSVDNVSRHNNNTQVANLGVDVLDTIRKDGLPTQESF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032421`
TK1151 ID	TkA08G173910
OH-1004 ID	LXL04_032421
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032421

Location Chr07:22504488-22508385 (+)

Description Similar to CAMTA5: Calmodulin-binding transcription activator 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16150`	Transcription activator.	Arabidopsis CAMTA family proteins enhance V-PPase expression in pollen.2003 · DOI: 10.1093/pcp/pcg137 Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.2017 · DOI: 10.1105/tpc.16.00669
`At3g16940`	Transcription activator that binds calmodulin in a calcium-dependent manner in vitro.	A novel family of calmodulin-binding transcription activators in multicellular organisms.2002 · DOI: 10.1074/jbc.m200268200
`At2g22300`	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'.	Calmodulin-binding transcription activator (CAMTA) 3 mediates biotic defense responses in Arabidopsis.2008 · DOI: 10.1016/j.febslet.2008.02.037 Ca(2+)/calmodulin regulates salicylic-acid-mediated plant immunity.2009 · DOI: 10.1038/nature07612 Roles for Arabidopsis CAMTA transcription factors in cold-regulated gene expression and freezing tolerance.2009 · DOI: 10.1105/tpc.108.063958 Brush and spray: a high-throughput systemic acquired resistance assay suitable for large-scale genetic screening.2011 · DOI: 10.1104/pp.111.182089 The calmodulin-binding transcription factor SIGNAL RESPONSIVE1 is a novel regulator of glucosinolate metabolism and herbivory tolerance in Arabidopsis.2012 · DOI: 10.1093/pcp/pcs143 Roles of CAMTA transcription factors and salicylic acid in configuring the low-temperature transcriptome and freezing tolerance of Arabidopsis.2013 · DOI: 10.1111/tpj.12205 A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.2014 · DOI: 10.1111/tpj.12620 Distinct roles for mitogen-activated protein kinase signaling and CALMODULIN-BINDING TRANSCRIPTIONAL ACTIVATOR3 in regulating the peak time and amplitude of the plant general stress response.2014 · DOI: 10.1104/pp.114.245944 Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.2017 · DOI: 10.1105/tpc.16.00669 Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005
`At5g64220`	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity).	Roles of CAMTA transcription factors and salicylic acid in configuring the low-temperature transcriptome and freezing tolerance of Arabidopsis.2013 · DOI: 10.1111/tpj.12205

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0490200`	Transcription activator that binds calmodulin in a calcium-dependent manner in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032421 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0106167 extracellular ATP signaling Biological Process

GO:1900367 positive regulation of defense response to insect Biological Process

KEGG gene cross-reference

ath:AT2G22300

ath:AT3G16940

ath:AT4G15200

ath:AT4G15950

ath:AT4G16150

ath:AT4G17100

ath:AT4G35335

dosa:Os07g0490200

osa:4343265

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.526

Rank 1 · LXL04_032421 · OH-1004

Nucleus0.410

Rank 2 · LXL04_032421 · OH-1004

Cell membrane0.123

Rank 3 · LXL04_032421 · OH-1004

Mitochondrion0.050

Rank 4 · LXL04_032421 · OH-1004

Golgi apparatus0.048

Rank 5 · LXL04_032421 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03859.22CG-130-143 aa

PF12796.14Ank_2524-596 aa

PF00023.37Ank535-565 aa

PF13637.13Ank_4539-593 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032421	`PF03859.22`	CG-1	30	143	1.1e-45	154.9
LXL04_032421	`PF12796.14`	Ank_2	524	596	4.4e-09	37.5
LXL04_032421	`PF00023.37`	Ank	535	565	3.1e-09	37.3
LXL04_032421	`PF13637.13`	Ank_4	539	593	5.4e-07	30.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23463`	Arabidopsis thaliana	Calmodulin-binding transcription activator 5	54.226%	Swiss-Prot	strong database homology
`Q9LSP8`	Arabidopsis thaliana	Calmodulin-binding transcription activator 6	55.104%	Swiss-Prot	strong database homology
`Q8GSA7`	Arabidopsis thaliana	Calmodulin-binding transcription activator 3	34.036%	Swiss-Prot	moderate database homology
`Q6NPP4`	Arabidopsis thaliana	Calmodulin-binding transcription activator 2	33.455%	Swiss-Prot	moderate database homology
`Q7XHR2`	Oryza sativa subsp. japonica	Calmodulin-binding transcription activator CBT	48.490%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card