LXL04_032368 | RubberDandelionOmics

Gene overview

LXL04_032368

Reference: OH-1004 Chr: Chr07 Coordinates: 21451484-21453890 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1782 bp · LXL04_032368|LXL04_032368|OH1004|cDNA

ATGCAGAAACTCTTTGGGGAAGAGGTTCTTTACCATGGTATGCCAAAATACCATACTCCAGAAGAGTCAAATCTCTTCTTATCCCTTGGTCCTCATGTTGATGTCTACTTCCCTCCTCGCAAGAGGTCAAGAGTCAGTGCCCCTTTCGTCTTATTCTCtgaacaaatcttcaaaaaacAGCAAACCACCATTGATGCCCTTCCTGATGAATGCCTCTTTGAGATCTTCACACGTGTCACTGGTACCCAAGAGAAAAACGC...

CDS

Download CDS FASTA

1782 bp · LXL04_032368|LXL04_032368|OH1004|CDS

ATGCAGAAACTCTTTGGGGAAGAGGTTCTTTACCATGGTATGCCAAAATACCATACTCCAGAAGAGTCAAATCTCTTCTTATCCCTTGGTCCTCATGTTGATGTCTACTTCCCTCCTCGCAAGAGGTCAAGAGTCAGTGCCCCTTTCGTCTTATTCTCTGAACAAATCTTCAAAAAACAGCAAACCACCATTGATGCCCTTCCTGATGAATGCCTCTTTGAGATCTTCACACGTGTCACTGGTACCCAAGAGAAAAACGC...

Protein

Download Protein FASTA

593 aa · LXL04_032368|LXL04_032368|OH1004|PROTEIN

MQKLFGEEVLYHGMPKYHTPEESNLFLSLGPHVDVYFPPRKRSRVSAPFVLFSEQIFKKQQTTIDALPDECLFEIFTRVTGTQEKNACASVSKRWLMLLSTIHKKEIKQNKIEDLEINNSLTRCLKGKKATDIRLAAISVGTSGHGGLDELSIYGNNARVVEIANECHLLEKLQLSHCPRISDKSLIAIANNCPNLTSLSIESCSNIKNEGLQEIGKKCPNLKSILIKNCSQIGDQGVASLVSSASSSLMKVKLHGLNVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032368`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032368

Location Chr07:21451484-21453890 (+)

Description Similar to EBF1: EIN3-binding F-box protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25490`	Component of SCF(EBF1) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (probably including EIN3 and EIL1).	EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2.2003 · DOI: 10.1016/s0092-8674(03)00968-1
`At5g25350`	Component of SCF(EBF1) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (probably including EIN3 and EIL1).	EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2.2003 · DOI: 10.1016/s0092-8674(03)00968-1
`At4g15475`	F-box/LRR-repeat protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032368 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010105 negative regulation of ethylene-activated signaling pathway Biological Process

GO:0010225 response to UV-C Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT2G25490

ath:AT4G15475

ath:AT5G25350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.820

Rank 1 · LXL04_032368 · OH-1004

Cytoplasm0.139

Rank 2 · LXL04_032368 · OH-1004

Cell membrane0.045

Rank 3 · LXL04_032368 · OH-1004

Plastid0.036

Rank 4 · LXL04_032368 · OH-1004

Endoplasmic reticulum0.020

Rank 5 · LXL04_032368 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29594.1LRR_SKP2158-333 aa

PF25372.2LRR_FBXL15162-295 aa

PF25372.2LRR_FBXL15169-217 aa

PF25372.2LRR_FBXL15301-430 aa

PF25372.2LRR_FBXL15455-581 aa

PF29594.1LRR_SKP2468-527 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032368	`PF29594.1`	LRR_SKP2	158	333	1.3e-23	84.3
LXL04_032368	`PF25372.2`	LRR_FBXL15	162	295	2.5e-22	79.7
LXL04_032368	`PF25372.2`	LRR_FBXL15	169	217	2.5e-22	79.7
LXL04_032368	`PF25372.2`	LRR_FBXL15	301	430	2.5e-22	79.7
LXL04_032368	`PF25372.2`	LRR_FBXL15	455	581	2.5e-22	79.7
LXL04_032368	`PF29594.1`	LRR_SKP2	468	527	1.3e-23	84.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKK0`	Arabidopsis thaliana	EIN3-binding F-box protein 1	51.420%	Swiss-Prot	strong database homology
`Q708Y0`	Arabidopsis thaliana	EIN3-binding F-box protein 2	47.673%	Swiss-Prot	moderate database homology
`Q9C5D2`	Arabidopsis thaliana	F-box/LRR-repeat protein 4	24.872%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card