LXL04_032256 | RubberDandelionOmics

Gene overview

LXL04_032256

Reference: OH-1004 Chr: Chr07 Coordinates: 19331832-19335492 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2103 bp · LXL04_032256|LXL04_032256|OH1004|cDNA

ATGTCGGTGCTCGTTCCGTTGCTGTTCATCTTTCTTGTTCTTGGTCCAGACTTCATTAATGGCGACACAGATCCATCCGATGTCGCTGCTCTGGTAGCCATGTATCAAGGATTAAATTCTCCGGGGCAATTAACCAAGTGGAGCTCCGGCGGCGGCGATCCCTGTGGAGATAACTGGAAAGGGGTTACTTGTTCGGGGTCAAGAGTCACGGAAATCAAACTTCCAAGTCTTGGACTCACTGGGGGAATCGGATTCCAGCT...

CDS

Download CDS FASTA

2103 bp · LXL04_032256|LXL04_032256|OH1004|CDS

ATGTCGGTGCTCGTTCCGTTGCTGTTCATCTTTCTTGTTCTTGGTCCAGACTTCATTAATGGCGACACAGATCCATCCGATGTCGCTGCTCTGGTAGCCATGTATCAAGGATTAAATTCTCCGGGGCAATTAACCAAGTGGAGCTCCGGCGGCGGCGATCCCTGTGGAGATAACTGGAAAGGGGTTACTTGTTCGGGGTCAAGAGTCACGGAAATCAAACTTCCAAGTCTTGGACTCACTGGGGGAATCGGATTCCAGCT...

Protein

Download Protein FASTA

700 aa · LXL04_032256|LXL04_032256|OH1004|PROTEIN

MSVLVPLLFIFLVLGPDFINGDTDPSDVAALVAMYQGLNSPGQLTKWSSGGGDPCGDNWKGVTCSGSRVTEIKLPSLGLTGGIGFQLSSLTSLTEFDISNNYLGNQMPFSLPPNAQRLNFAGCGYTGSLPWSISQMASLRYLNVAHNQISGQLPDMFGQLPSLTTLDLSSNSFTGDLPQSISLLSSANNMYLQNNQFTGSIDVLANLPLKTLNVANNKFTGWIPSQLRNINFQNEGNSWNTGPAPPPPPGTPAAGGGGQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032256`
TK1151 ID	TkA08G161640
OH-1004 ID	LXL04_032256
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032256

Location Chr07:19331832-19335492 (+)

Description Similar to SRF7: Protein STRUBBELIG-RECEPTOR FAMILY 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14350`	Protein STRUBBELIG-RECEPTOR FAMILY 7.	No verified direct reference in this release
`At1g53730`	Protein STRUBBELIG-RECEPTOR FAMILY 6.	No verified direct reference in this release
`At4g22130`	Protein STRUBBELIG-RECEPTOR FAMILY 8.	No verified direct reference in this release
`At1g78980`	Protein STRUBBELIG-RECEPTOR FAMILY 5.	No verified direct reference in this release
`At3g13065`	Acts as a direct positive regulator of leaf size but not leaf shape.	Molecular characterisation of the STRUBBELIG-RECEPTOR FAMILY of genes encoding putative leucine-rich repeat receptor-like kinases in Arabidopsis thaliana.2007 · DOI: 10.1186/1471-2229-7-16

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032256 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G53730

ath:AT1G78980

ath:AT3G13065

ath:AT3G14350

ath:AT4G22130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.855

Rank 1 · LXL04_032256 · OH-1004

Cytoplasm0.082

Rank 2 · LXL04_032256 · OH-1004

Endoplasmic reticulum0.076

Rank 3 · LXL04_032256 · OH-1004

Nucleus0.057

Rank 4 · LXL04_032256 · OH-1004

Lysosome / Vacuole0.027

Rank 5 · LXL04_032256 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_225-65 aa

PF23598.2LRR_14130-196 aa

PF12799.14LRR_4138-176 aa

PF13855.13LRR_8138-197 aa

PF00069.32Pkinase421-666 aa

PF07714.24PK_Tyr_Ser-Thr423-667 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032256	`PF08263.18`	LRRNT_2	25	65	2.3e-10	41.3
LXL04_032256	`PF23598.2`	LRR_14	130	196	1.5e-06	27.9
LXL04_032256	`PF12799.14`	LRR_4	138	176	4.7e-12	46.5
LXL04_032256	`PF13855.13`	LRR_8	138	197	8.8e-09	35.7
LXL04_032256	`PF00069.32`	Pkinase	421	666	2.1e-32	113.3
LXL04_032256	`PF07714.24`	PK_Tyr_Ser-Thr	423	667	1.7e-36	126.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUL4`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 7	61.516%	Swiss-Prot	strong database homology
`Q9C8M9`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 6	60.084%	Swiss-Prot	strong database homology
`Q6R2J8`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 8	50.354%	Swiss-Prot	strong database homology
`Q6R2K1`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 5	46.713%	Swiss-Prot	moderate database homology
`Q6R2K2`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 4	45.743%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card