LXL04_032163 | RubberDandelionOmics

Gene overview

LXL04_032163

Reference: OH-1004 Chr: Chr07 Coordinates: 17707195-17709506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1695 bp · LXL04_032163|LXL04_032163|OH1004|cDNA

atgGGGAGGGGAACGAGAGAAATAAATCCTGAGTTTTTGAAAATTGGGCTTGCTGTAGTTTTTTCTATTGGCGGGATGCTTTATACTTTTATCAGAAAGAAAAGGACCAATTCCTCTATATTTCCATCTGATCCTACTAAATCTCCAGAGGTGATTTCAGCAAAAGAATCGCGGAGCTCAAAAAGCGAGCATCATGCATCCTATAGAACACAAAATTCATGCCAATTTGATCCTTTGGCAACTGATAAACATGAGGATTT...

CDS

Download CDS FASTA

1695 bp · LXL04_032163|LXL04_032163|OH1004|CDS

ATGGGGAGGGGAACGAGAGAAATAAATCCTGAGTTTTTGAAAATTGGGCTTGCTGTAGTTTTTTCTATTGGCGGGATGCTTTATACTTTTATCAGAAAGAAAAGGACCAATTCCTCTATATTTCCATCTGATCCTACTAAATCTCCAGAGGTGATTTCAGCAAAAGAATCGCGGAGCTCAAAAAGCGAGCATCATGCATCCTATAGAACACAAAATTCATGCCAATTTGATCCTTTGGCAACTGATAAACATGAGGATTT...

Protein

Download Protein FASTA

564 aa · LXL04_032163|LXL04_032163|OH1004|PROTEIN

MGRGTREINPEFLKIGLAVVFSIGGMLYTFIRKKRTNSSIFPSDPTKSPEVISAKESRSSKSEHHASYRTQNSCQFDPLATDKHEDLQNSRLNADEDTYLLPEFYDLVKEFDTASMKTNTELPNPRVAKDDHEQEIKNLRNMVETLKEREKNLEIQLLEYYGLKEQETAFIELQNRLKLNNMEAKLLNLKIESLQTDNKRLQTQMADYTKVLADLEAAKAKIKVLQRKLRLETAQNKERILDLQQRVKKMQEDEHEDVIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032163`
TK1151 ID	TkA08G153400
OH-1004 ID	LXL04_032163
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032163

Location Chr07:17707195-17709506 (+)

Description Similar to CHUP1: Protein CHUP1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25690`	Required for the positioning and movement of chloroplasts.	Chloroplast unusual positioning1 is essential for proper chloroplast positioning.2003 · DOI: 10.1105/tpc.016428 Chloroplast outer envelope protein CHUP1 is essential for chloroplast anchorage to the plasma membrane and chloroplast movement.2008 · DOI: 10.1104/pp.108.123075

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032163 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009902 chloroplast relocation Biological Process

GO:0030041 actin filament polymerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0005102 signaling receptor binding Molecular Function

GO:0005522 profilin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT3G25690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.403

Rank 1 · LXL04_032163 · OH-1004

Cytoplasm0.362

Rank 2 · LXL04_032163 · OH-1004

Nucleus0.288

Rank 3 · LXL04_032163 · OH-1004

Plastid0.071

Rank 4 · LXL04_032163 · OH-1004

Endoplasmic reticulum0.059

Rank 5 · LXL04_032163 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LI74`	Arabidopsis thaliana	Protein CHUP1, chloroplastic	38.257%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card