LXL04_032126 | RubberDandelionOmics

Gene overview

LXL04_032126

Reference: OH-1004 Chr: Chr07 Coordinates: 17184466-17185528 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · LXL04_032126|LXL04_032126|OH1004|cDNA

ATGGATTTTTGGCCGGCGTTTCTCGCAAGCAGTTGGGGCAAAGAGTTTGTCGCCGGAGGAATTGGGGGAATCGCCGGAATTATCGCCGGATACCCTCTTGATACCGTTAGAGTCATACAACAAAACTGTCAAGACGCTTATGCGTTCAGCATCCTGAAAAATATTACAGCTAAAGAAGGACCACTTGCGCTTTTTAGAGGCATGGGTGCACCCCTTGCCACTGTTACCTTTCAGAATGCAGTGGTCTTTCAAAGTAACGC...

CDS

Download CDS FASTA

900 bp · LXL04_032126|LXL04_032126|OH1004|CDS

ATGGATTTTTGGCCGGCGTTTCTCGCAAGCAGTTGGGGCAAAGAGTTTGTCGCCGGAGGAATTGGGGGAATCGCCGGAATTATCGCCGGATACCCTCTTGATACCGTTAGAGTCATACAACAAAACTGTCAAGACGCTTATGCGTTCAGCATCCTGAAAAATATTACAGCTAAAGAAGGACCACTTGCGCTTTTTAGAGGCATGGGTGCACCCCTTGCCACTGTTACCTTTCAGAATGCAGTGGTCTTTCAAAGTAACGC...

Protein

Download Protein FASTA

299 aa · LXL04_032126|LXL04_032126|OH1004|PROTEIN

MDFWPAFLASSWGKEFVAGGIGGIAGIIAGYPLDTVRVIQQNCQDAYAFSILKNITAKEGPLALFRGMGAPLATVTFQNAVVFQSNATLSRAFDSYRHPSEPPSYGSIALGGTGAGAIQSFVLTPIELVKIRLQLHEQSERGPMSVAKNIVRTEGWKGMFRGLTVTIIRDAPSFGFYFWTYEYGREILHPGCRKSGQESFTTMIAAGGGAGVASWLCCYPIDVVKTRLQAQSPSSLVKYSGIVDCFRKSVKNDGMGVLFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032126`
TK1151 ID	TkA08G151660
OH-1004 ID	LXL04_032126
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032126

Location Chr07:17184466-17185528 (+)

Description Similar to BAC2: Mitochondrial arginine transporter BAC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79900`	Mitochondrial arginine transporter that catalyzes the counter-exchange of arginine with lysine, ornithine, arginine, histidine and citrulline.	Arabidopsis mitochondria have two basic amino acid transporters with partially overlapping specificities and differential expression in seedling development.2006 · DOI: 10.1016/j.bbabio.2006.03.025 Mutations in the hyperosmotic stress-responsive mitochondrial BASIC AMINO ACID CARRIER2 enhance proline accumulation in Arabidopsis.2010 · DOI: 10.1104/pp.109.152371

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032126 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006972 hyperosmotic response Biological Process

GO:0015822 ornithine transport Biological Process

GO:0055129 L-proline biosynthetic process Biological Process

GO:0089709 L-histidine transmembrane transport Biological Process

GO:1902616 O-acyl-L-carnitine transmembrane transport Biological Process

GO:1903401 L-lysine transmembrane transport Biological Process

GO:1903826 L-arginine transmembrane transport Biological Process

GO:1990575 mitochondrial L-ornithine transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0000064 L-ornithine transmembrane transporter activity Molecular Function

GO:0005289 high-affinity L-arginine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G79900

bta:507686

rno:314441

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.870

Rank 1 · LXL04_032126 · OH-1004

Cytoplasm0.033

Rank 2 · LXL04_032126 · OH-1004

Plastid0.028

Rank 3 · LXL04_032126 · OH-1004

Nucleus0.024

Rank 4 · LXL04_032126 · OH-1004

Cell membrane0.015

Rank 5 · LXL04_032126 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr11-93 aa

PF00153.33Mito_carr106-189 aa

PF00153.33Mito_carr197-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032126	`PF00153.33`	Mito_carr	11	93	2.5e-65	217.0
LXL04_032126	`PF00153.33`	Mito_carr	106	189	2.5e-65	217.0
LXL04_032126	`PF00153.33`	Mito_carr	197	289	2.5e-65	217.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA93`	Arabidopsis thaliana	Mitochondrial arginine transporter BAC2	61.644%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card