LXL04_032114 | RubberDandelionOmics

Gene overview

LXL04_032114

Reference: OH-1004 Chr: Chr07 Coordinates: 16989833-16993825 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1911 bp · LXL04_032114|LXL04_032114|OH1004|cDNA

ATGAGTCAATCGCAGTGCTCCATTTTTGTCGACCCCTTTGAAGAACAGTCTGTTCTCTTTCTAAATCCTCGAACTCATCGACTTCCTTCGGATGCGTTGAAATCCAAAGACCTCGAAGCAACTCACAAGTATATGAAATCAATGGCGTTACAAAGCCCTGATAAGCATTATGAGAAAACAAAGTCAGTTATAGATGGCCATTCAGAATTCCTCAAGAACAAGAAAACTGAAGCTTCTATAAAAGAGAAGGAAAACCCTCA...

CDS

Download CDS FASTA

1911 bp · LXL04_032114|LXL04_032114|OH1004|CDS

ATGAGTCAATCGCAGTGCTCCATTTTTGTCGACCCCTTTGAAGAACAGTCTGTTCTCTTTCTAAATCCTCGAACTCATCGACTTCCTTCGGATGCGTTGAAATCCAAAGACCTCGAAGCAACTCACAAGTATATGAAATCAATGGCGTTACAAAGCCCTGATAAGCATTATGAGAAAACAAAGTCAGTTATAGATGGCCATTCAGAATTCCTCAAGAACAAGAAAACTGAAGCTTCTATAAAAGAGAAGGAAAACCCTCA...

Protein

Download Protein FASTA

636 aa · LXL04_032114|LXL04_032114|OH1004|PROTEIN

MSQSQCSIFVDPFEEQSVLFLNPRTHRLPSDALKSKDLEATHKYMKSMALQSPDKHYEKTKSVIDGHSEFLKNKKTEASIKEKENPQHHRPGLVRKRAKFSMKPDTSLSNTVMEPTLELDQLQDPEEFFAAFEKFENTKKELKKQRGEDVNEVKTSTTVRKLRPEIPRKRKASYKHYEYSSQSQDDILQDNIQSPPQQESLSNLQSEKENAVGSITKTEKRVHSLFDELLASGINKLDANQAMSFLKDRINIKSVDITDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032114`
TK1151 ID	TkA08G151090
OH-1004 ID	LXL04_032114
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.600
Protein coverage (%)	TK1151 98.537 / OH-1004 63.365 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032114

Location Chr07:16989833-16993825 (+)

Description Similar to CENPC: Centromere protein C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15660`	Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032114 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0051301 cell division Biological Process

GO:0051315 attachment of mitotic spindle microtubules to kinetochore Biological Process

GO:0051382 kinetochore assembly Biological Process

GO:0051455 spindle attachment to meiosis I kinetochore Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000776 kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0019237 centromeric DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G15660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930

Rank 1 · LXL04_032114 · OH-1004

Cytoplasm0.184

Rank 2 · LXL04_032114 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_032114 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_032114 · OH-1004

Mitochondrion0.013

Rank 5 · LXL04_032114 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28563.1CENPC_C595-636 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032114	`PF28563.1`	CENPC_C	595	636	5.3e-21	74.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66LG9`	Arabidopsis thaliana	Centromere protein C	59.756%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card