LXL04_032036 | RubberDandelionOmics

Gene overview

LXL04_032036

Reference: OH-1004 Chr: Chr07 Coordinates: 15347074-15348618 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1365 bp · LXL04_032036|LXL04_032036|OH1004|cDNA

atgggatacgggaattatagaaaaaggttaagaatatacaaacttaaacgaaataatGTACTGAAACTATCAAAGAACCGATTACATGGCAATGTACTTGTTGGAAACTTAAGTTTGAGTTACATCCAAGAGCTCTACTTGGATAGCAACTATTTCACTGGTAAAATTGCAAATGAGCCCACCCAATATGATAACCTACTGATTATGGATATTAGCAACAATTTTTTTACTGGCATGATCCCTAGGTGGATAGGCAACAT...

CDS

Download CDS FASTA

1365 bp · LXL04_032036|LXL04_032036|OH1004|CDS

ATGGGATACGGGAATTATAGAAAAAGGTTAAGAATATACAAACTTAAACGAAATAATGTACTGAAACTATCAAAGAACCGATTACATGGCAATGTACTTGTTGGAAACTTAAGTTTGAGTTACATCCAAGAGCTCTACTTGGATAGCAACTATTTCACTGGTAAAATTGCAAATGAGCCCACCCAATATGATAACCTACTGATTATGGATATTAGCAACAATTTTTTTACTGGCATGATCCCTAGGTGGATAGGCAACAT...

Protein

Download Protein FASTA

454 aa · LXL04_032036|LXL04_032036|OH1004|PROTEIN

MGYGNYRKRLRIYKLKRNNVLKLSKNRLHGNVLVGNLSLSYIQELYLDSNYFTGKIANEPTQYDNLLIMDISNNFFTGMIPRWIGNMSKLSELAVRNNSLEGRFPCGTTSYSFLDISQNSFSGPVPTCLNLQYVEHLHLGSNRFTGLIPNYFCNLNMVLFQRSCANYAMRVCWISHNAFSGLIPSCLKNITGPSYLAFLKKTVVWYPTTSSYDYKSVVWRWQPSHVNNEGVEMQDEVEFTTKSLFLGYKGNILDYMSGLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032036`
TK1151 ID	TkA08G143240
OH-1004 ID	LXL04_032036
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 70.968 / OH-1004 24.229 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032036

Location Chr07:15347074-15348618 (+)

Description Similar to RLP1: Receptor-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74190`	Receptor-like protein 15.	No verified direct reference in this release
`At1g07390`	Involved in plant defense.	The receptor-like protein ReMAX of Arabidopsis detects the microbe-associated molecular pattern eMax from Xanthomonas.2013 · DOI: 10.1105/tpc.113.110833 Perception of the novel MAMP eMax from different Xanthomonas species requires the Arabidopsis receptor-like protein ReMAX and the receptor kinase SOBIR.2013 · DOI: 10.4161/psb.27408
`At2g25470`	Receptor like protein 21.	No verified direct reference in this release
`At3g53240`	Receptor-like protein 45.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032036 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002218 activation of innate immune response Biological Process

GO:0002242 defense response to parasitic plant Biological Process

GO:0002752 cell surface pattern recognition receptor signaling pathway Biological Process

GO:0002768 immune response-regulating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009986 cell surface Cellular Component

GO:0038187 pattern recognition receptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G74190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.854

Rank 1 · LXL04_032036 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_032036 · OH-1004

Cytoplasm0.061

Rank 3 · LXL04_032036 · OH-1004

Nucleus0.035

Rank 4 · LXL04_032036 · OH-1004

Lysosome / Vacuole0.031

Rank 5 · LXL04_032036 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_842-100 aa

PF13855.13LRR_8296-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032036	`PF13855.13`	LRR_8	42	100	8.6e-15	55.0
LXL04_032036	`PF13855.13`	LRR_8	296	338	8.6e-15	55.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6A8`	Arabidopsis thaliana	Receptor-like protein 15	35.849%	Swiss-Prot	moderate database homology
`Q9LNV9`	Arabidopsis thaliana	Receptor-like protein 1	36.247%	Swiss-Prot	moderate database homology
`Q9SKK2`	Arabidopsis thaliana	Receptor like protein 21	35.470%	Swiss-Prot	moderate database homology
`F4J9A8`	Arabidopsis thaliana	Receptor-like protein 45	34.958%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card