LXL04_031984 | RubberDandelionOmics

Gene overview

LXL04_031984

Reference: OH-1004 Chr: Chr07 Coordinates: 14376120-14380758 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2796 bp · LXL04_031984|LXL04_031984|OH1004|cDNA

ATGCAAAAAATGGGTACGGACGACGGAAGAGCTGGGCTGCCGGACAAGTATTATCACTCCGACACGGAGGTTGTCGGTGTAGACAGGAAGGCATTCAGCGGTCCGTTAAGTGGGCCGTTGAATAAACGAGGTCACCGGAAAAGCGCTAGGTTTAATATTCCCGACGGCGCTCCGGGGAGTAGCAGCGGCAGCGTGAAGTCCAACAATGACGACTACGTTGAAATTACTTTGGACGTCCGTGACGACTCGGTGGCGTTGCA...

CDS

Download CDS FASTA

2796 bp · LXL04_031984|LXL04_031984|OH1004|CDS

ATGCAAAAAATGGGTACGGACGACGGAAGAGCTGGGCTGCCGGACAAGTATTATCACTCCGACACGGAGGTTGTCGGTGTAGACAGGAAGGCATTCAGCGGTCCGTTAAGTGGGCCGTTGAATAAACGAGGTCACCGGAAAAGCGCTAGGTTTAATATTCCCGACGGCGCTCCGGGGAGTAGCAGCGGCAGCGTGAAGTCCAACAATGACGACTACGTTGAAATTACTTTGGACGTCCGTGACGACTCGGTGGCGTTGCA...

Protein

Download Protein FASTA

931 aa · LXL04_031984|LXL04_031984|OH1004|PROTEIN

MQKMGTDDGRAGLPDKYYHSDTEVVGVDRKAFSGPLSGPLNKRGHRKSARFNIPDGAPGSSSGSVKSNNDDYVEITLDVRDDSVALHSVKTAGGADVEDPELTLLAKGLEKRASFGSSVVRNASARIRQVSEELKRLTSFSKRQPVGRLDRTKSAATYALKGLKFISKNDGGAAWAALEKRFDDLSEKTNGLLPRSLFWECIGMNKDSKEFAGELFDALTRRRNIVGDSINKEQLKDFWHQISDQSFDSRLQTFFDMVDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031984`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031984

Location Chr07:14376120-14380758 (-)

Description Similar to RBOHC: Respiratory burst oxidase homolog protein C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47910`	Calcium-dependent NADPH oxidase that generates superoxide.	Arabidopsis gp91phox homologues AtrbohD and AtrbohF are required for accumulation of reactive oxygen intermediates in the plant defense response.2002 · DOI: 10.1073/pnas.012452499 NADPH oxidase AtrbohD and AtrbohF genes function in ROS-dependent ABA signaling in Arabidopsis.2003 · DOI: 10.1093/emboj/cdg277 Cytosolic ascorbate peroxidase 1 is a central component of the reactive oxygen gene network of Arabidopsis.2005 · DOI: 10.1105/tpc.104.026971 Extracellular ATP induces the accumulation of superoxide via NADPH oxidases in Arabidopsis.2006 · DOI: 10.1104/pp.105.073072 The role of NADPH oxidase and MAP kinase phosphatase in UV-B-dependent gene expression in Arabidopsis.2006 · DOI: 10.1111/j.1365-3040.2006.01555.x Arabidopsis thaliana expresses multiple lines of defense to counterattack Erwinia chrysanthemi.2007 · DOI: 10.1094/mpmi-20-7-0794 The MAP4 Kinase SIK1 Ensures Robust Extracellular ROS Burst and Antibacterial Immunity in Plants.2018 · DOI: 10.1016/j.chom.2018.08.007
`At5g51060`	Calcium-dependent NADPH oxidase that generates superoxide.	Reactive oxygen species produced by NADPH oxidase regulate plant cell growth.2003 · DOI: 10.1038/nature01485 Hydrogen peroxide mediates plant root cell response to nutrient deprivation.2004 · DOI: 10.1073/pnas.0401707101

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031984 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007231 osmosensory signaling pathway Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0009408 response to heat Biological Process

GO:0009611 response to wounding Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0033198 response to ATP Biological Process

GO:0033500 carbohydrate homeostasis Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

KEGG gene cross-reference

ath:AT5G47910

ath:AT5G51060

sot:102586476

sot:102598898

sot:102603596

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.851

Rank 1 · LXL04_031984 · OH-1004

Cytoplasm0.134

Rank 2 · LXL04_031984 · OH-1004

Endoplasmic reticulum0.075

Rank 3 · LXL04_031984 · OH-1004

Nucleus0.041

Rank 4 · LXL04_031984 · OH-1004

Golgi apparatus0.039

Rank 5 · LXL04_031984 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08414.17NADPH_Ox148-249 aa

PF13499.13EF-hand_7249-310 aa

PF00036.39EF-hand_1251-276 aa

PF01794.26Ferric_reduct416-563 aa

PF08022.19FAD_binding_8607-722 aa

PF08030.18NAD_binding_6728-913 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031984	`PF08414.17`	NADPH_Ox	148	249	2.3e-38	131.3
LXL04_031984	`PF13499.13`	EF-hand_7	249	310	7.9e-09	36.5
LXL04_031984	`PF00036.39`	EF-hand_1	251	276	4.2e-07	29.8
LXL04_031984	`PF01794.26`	Ferric_reduct	416	563	1.7e-12	48.2
LXL04_031984	`PF08022.19`	FAD_binding_8	607	722	2.8e-37	127.8
LXL04_031984	`PF08030.18`	NAD_binding_6	728	913	1.5e-49	168.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIJ0`	Arabidopsis thaliana	Respiratory burst oxidase homolog protein D	68.730%	Swiss-Prot	strong database homology
`O81210`	Arabidopsis thaliana	Respiratory burst oxidase homolog protein C	68.094%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card