RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_031965
Reference: OH-1004 Chr: Chr07 Coordinates: 13958254-13959672 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1419 bp · LXL04_031965|LXL04_031965|OH1004|cDNA

ATGGCTGATAGAGTGTTGAAGCTTTCAATGAATTTCTGTGAAATAGATTACACCCTACTGATTTTCAAATGCATTAATTTCCCAGATACATTCTGTGTAAATACTGTTATCAAGGCATATGCTTCCTGTTCGCTACCCACCAAAGCTGTAGGGTTCTATTTTGAAATGCTTGAAGAAGACGGCGTGTTGTTTAAGCCCAATAGTTTTACATTCCCATCTATGATTAGCTCGTGCACAAAAACAAAAGATCCTAATTTAGG...

CDS

Download CDS FASTA

1419 bp · LXL04_031965|LXL04_031965|OH1004|CDS

ATGGCTGATAGAGTGTTGAAGCTTTCAATGAATTTCTGTGAAATAGATTACACCCTACTGATTTTCAAATGCATTAATTTCCCAGATACATTCTGTGTAAATACTGTTATCAAGGCATATGCTTCCTGTTCGCTACCCACCAAAGCTGTAGGGTTCTATTTTGAAATGCTTGAAGAAGACGGCGTGTTGTTTAAGCCCAATAGTTTTACATTCCCATCTATGATTAGCTCGTGCACAAAAACAAAAGATCCTAATTTAGG...

Protein

Download Protein FASTA

472 aa · LXL04_031965|LXL04_031965|OH1004|PROTEIN

MADRVLKLSMNFCEIDYTLLIFKCINFPDTFCVNTVIKAYASCSLPTKAVGFYFEMLEEDGVLFKPNSFTFPSMISSCTKTKDPNLGQKCHGQAVKVGVDRTLQVENALIHMYSGCGLNNTAWKVFDEMSIRDLVSWNSIVDGYVKSNNMEASHKLFDKMPVRNVVSWNAMMKGYLDAKNPGLVLKLFRKMVKTDVNMNATSAVTILTACGRSCRLKEGKSVHGALIRMSMDVTLIIGTSLIDMYSKNKRPDIANIIFNT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_031965
TK1151 IDTkA08G138780
OH-1004 IDLXL04_031965
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.300
Protein coverage (%)TK1151 88.224 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_031965
LocationChr07:13958254-13959672 (+)
DescriptionSimilar to At3g51320: Pentatricopeptide repeat-containing protein At3g51320
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g51320 Pentatricopeptide repeat-containing protein At3g51320. No verified direct reference in this release
At3g62890 Pentatricopeptide repeat-containing protein At3g62890. No verified direct reference in this release
At2g22410 Pentatricopeptide repeat-containing protein At2g22410, mitochondrial. No verified direct reference in this release
At1g74630 Pentatricopeptide repeat-containing protein At1g74630. No verified direct reference in this release
At5g61800 Pentatricopeptide repeat-containing protein At5g61800. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031965 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009451 RNA modification Biological Process
GO:0016556 mRNA modification Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0003723 RNA binding Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
ath:AT2G22410
ath:AT3G51320
ath:AT3G62890
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.631
Rank 1 · LXL04_031965 · OH-1004
Plastid0.203
Rank 2 · LXL04_031965 · OH-1004
Nucleus0.045
Rank 3 · LXL04_031965 · OH-1004
Cytoplasm0.033
Rank 4 · LXL04_031965 · OH-1004
Cell membrane0.006
Rank 5 · LXL04_031965 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_228-79 aa
PF13041.13PPR_2133-165 aa
PF01535.27PPR135-164 aa
PF13041.13PPR_2163-211 aa
PF01535.27PPR166-193 aa
PF13041.13PPR_2264-314 aa
PF01535.27PPR267-294 aa
PF20431.5E_motif391-450 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_031965PF13041.13PPR_228798.6e-42141.7
LXL04_031965PF13041.13PPR_21331658.6e-42141.7
LXL04_031965PF01535.27PPR1351645.6e-44146.1
LXL04_031965PF13041.13PPR_21632118.6e-42141.7
LXL04_031965PF01535.27PPR1661935.6e-44146.1
LXL04_031965PF13041.13PPR_22643148.6e-42141.7
LXL04_031965PF01535.27PPR2672945.6e-44146.1
LXL04_031965PF20431.5E_motif3914505.1e-0627.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q0WVU0Arabidopsis thalianaPentatricopeptide repeat-containing protein At3g5132046.841%Swiss-Protmoderate database homology
Q683I9Arabidopsis thalianaPentatricopeptide repeat-containing protein At3g6289034.910%Swiss-Protmoderate database homology
Q9SJZ3Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g22410, mitochondrial33.879%Swiss-Protmoderate database homology
Q9CA54Arabidopsis thalianaPentatricopeptide repeat-containing protein At1g7463030.898%Swiss-Protmoderate database homology
Q9FLS9Arabidopsis thalianaPentatricopeptide repeat-containing protein At5g6180032.867%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser