LXL04_031954 | RubberDandelionOmics

Gene overview

LXL04_031954

Reference: OH-1004 Chr: Chr07 Coordinates: 13731865-13751036 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2238 bp · LXL04_031954|LXL04_031954|OH1004|cDNA

ATGGATCAGATTCACAGATTCCTAAACATTCTTTCTATTATTCTATCGGTCATCTCATGCATCTTCCTCTTGCCGGCAATTTCGTTGTTCCGCGTCTTGAGGTTCTGTATCAGATCTATATACCGAGaaaaactcgccggaaaagtgGTGCTTATTACCGGTGCTTCATCCGGTATCGGCGAGCATTTGGCGTATGAGTATGCAAAACATGGAGCGAGTCTAGCGTTAGTGGCGAGAAGAGAGGAACTGCTTGCGACGGT...

CDS

Download CDS FASTA

2238 bp · LXL04_031954|LXL04_031954|OH1004|CDS

ATGGATCAGATTCACAGATTCCTAAACATTCTTTCTATTATTCTATCGGTCATCTCATGCATCTTCCTCTTGCCGGCAATTTCGTTGTTCCGCGTCTTGAGGTTCTGTATCAGATCTATATACCGAGAAAAACTCGCCGGAAAAGTGGTGCTTATTACCGGTGCTTCATCCGGTATCGGCGAGCATTTGGCGTATGAGTATGCAAAACATGGAGCGAGTCTAGCGTTAGTGGCGAGAAGAGAGGAACTGCTTGCGACGGT...

Protein

Download Protein FASTA

745 aa · LXL04_031954|LXL04_031954|OH1004|PROTEIN

MDQIHRFLNILSIILSVISCIFLLPAISLFRVLRFCIRSIYREKLAGKVVLITGASSGIGEHLAYEYAKHGASLALVARREELLATVAGKAKELGAPEAIVIKADVSKIQDCKRLVDETINHFVDCLINNAGILKIGLFEDEGCINDYTSIMDVNYWGSVNATHFALPHLRKCKGRIVVISSTGGWFNMPGISVYNASKVAQQSFFETLRIEVASDIGITMVTPGVVTTPLASEEVLNEHLAYEYAKHGARLALVARREE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031954`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031954

Location Chr07:13731865-13751036 (+)

Description Similar to SOP2: 11-beta-hydroxysteroid dehydrogenase A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50690`	11-beta-hydroxysteroid dehydrogenase-like 4B.	No verified direct reference in this release
`At5g50590`	11-beta-hydroxysteroid dehydrogenase-like 4A.	No verified direct reference in this release
`At3g47350`	11-beta-hydroxysteroid dehydrogenase-like 2.	No verified direct reference in this release
`At5g50700`	Catalyzes 11-beta, 17-beta-hydroxysteroid and reduces 17- beta-ketosteroids.	Regulation of HSD1 in seeds of Arabidopsis thaliana.2009 · DOI: 10.1093/pcp/pcp092

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031954 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006694 steroid biosynthetic process Biological Process

GO:0008202 steroid metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0004303 estradiol 17-beta-dehydrogenase [NAD(P)+] activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0070523 11-beta-hydroxysteroid dehydrogenase (NAD+) activity Molecular Function

GO:0070524 11-beta-hydroxysteroid dehydrogenase (NADP+) activity Molecular Function

GO:0072582 17-beta-hydroxysteroid dehydrogenase (NADP+) activity Molecular Function

KEGG gene cross-reference

ath:AT5G50590

ath:AT5G50690

sind:105158152

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.323

Rank 1 · LXL04_031954 · OH-1004

Endoplasmic reticulum0.285

Rank 2 · LXL04_031954 · OH-1004

Mitochondrion0.126

Rank 3 · LXL04_031954 · OH-1004

Lysosome / Vacuole0.123

Rank 4 · LXL04_031954 · OH-1004

Cell membrane0.113

Rank 5 · LXL04_031954 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short48-235 aa

PF08659.17KR50-210 aa

PF13561.13adh_short_C254-234 aa

PF13561.13adh_short_C2239-411 aa

PF00106.32adh_short240-412 aa

PF08659.17KR241-388 aa

PF00106.32adh_short485-671 aa

PF08659.17KR487-648 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031954	`PF00106.32`	adh_short	48	235	6.8e-122	404.9
LXL04_031954	`PF08659.17`	KR	50	210	6.1e-26	92.1
LXL04_031954	`PF13561.13`	adh_short_C2	54	234	1.1e-80	271.3
LXL04_031954	`PF13561.13`	adh_short_C2	239	411	1.1e-80	271.3
LXL04_031954	`PF00106.32`	adh_short	240	412	6.8e-122	404.9
LXL04_031954	`PF08659.17`	KR	241	388	6.1e-26	92.1
LXL04_031954	`PF00106.32`	adh_short	485	671	6.8e-122	404.9
LXL04_031954	`PF08659.17`	KR	487	648	6.1e-26	92.1
LXL04_031954	`PF01370.28`	Epimerase	487	619	4.1e-10	40.2
LXL04_031954	`PF13561.13`	adh_short_C2	491	671	1.1e-80	271.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUF2`	Arabidopsis thaliana	11-beta-hydroxysteroid dehydrogenase-like 4B	48.134%	Swiss-Prot	weak database homology
`P0DKC7`	Arabidopsis thaliana	11-beta-hydroxysteroid dehydrogenase-like 4A	48.134%	Swiss-Prot	weak database homology
`Q9STY8`	Arabidopsis thaliana	11-beta-hydroxysteroid dehydrogenase-like 2	43.434%	Swiss-Prot	weak database homology
`P0DKC6`	Arabidopsis thaliana	11-beta-hydroxysteroid dehydrogenase 1B	45.172%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card