LXL04_031753 | RubberDandelionOmics

Gene overview

LXL04_031753

Reference: OH-1004 Chr: Chr07 Coordinates: 10711341-10711940 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · LXL04_031753|LXL04_031753|OH1004|cDNA

ATGTATTTGCAGGTTCCACTTTACAAACATATTGCTGATCTTTCTGGCAGAGGAAACCATGTACTTCCTGTTCCTGCCTTCACACTCATTAATGGTGGAAAACATGCTGGGAACAATTTGGCTTTAAGAGACATAATAGTTCTTCCAATTGGAGCAAAAAGATTTGAAGAAGCAATGCAGATGGGTTCTGAGACATATCATCACTTGAAGGCTGTTATTACAGAGAAATTTGGTGCACAAGGATGTAATGTTGGTGAAGA...

CDS

Download CDS FASTA

312 bp · LXL04_031753|LXL04_031753|OH1004|CDS

ATGTATTTGCAGGTTCCACTTTACAAACATATTGCTGATCTTTCTGGCAGAGGAAACCATGTACTTCCTGTTCCTGCCTTCACACTCATTAATGGTGGAAAACATGCTGGGAACAATTTGGCTTTAAGAGACATAATAGTTCTTCCAATTGGAGCAAAAAGATTTGAAGAAGCAATGCAGATGGGTTCTGAGACATATCATCACTTGAAGGCTGTTATTACAGAGAAATTTGGTGCACAAGGATGTAATGTTGGTGAAGA...

Protein

Download Protein FASTA

103 aa · LXL04_031753|LXL04_031753|OH1004|PROTEIN

MYLQVPLYKHIADLSGRGNHVLPVPAFTLINGGKHAGNNLALRDIIVLPIGAKRFEEAMQMGSETYHHLKAVITEKFGAQGCNVGEDGGFAPNISRHTSINIV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031753`
TK1151 ID	TkA04G197040
OH-1004 ID	LXL04_031753
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031753

Location Chr07:10711341-10711940 (+)

Description Similar to ENO3: Cytosolic enolase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29560`	Cytosolic enolase 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031753 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004634 phosphopyruvate hydratase activity Molecular Function

KEGG gene cross-reference

ath:AT2G29560

rcu:8288376

sly:544068

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.294

Rank 1 · LXL04_031753 · OH-1004

Mitochondrion0.218

Rank 2 · LXL04_031753 · OH-1004

Nucleus0.186

Rank 3 · LXL04_031753 · OH-1004

Extracellular0.173

Rank 4 · LXL04_031753 · OH-1004

Plastid0.088

Rank 5 · LXL04_031753 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00113.29Enolase_C20-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031753	`PF00113.29`	Enolase_C	20	97	4.5e-29	102.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZW34`	Arabidopsis thaliana	Cytosolic enolase 3	71.739%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card