LXL04_031636 | RubberDandelionOmics

Gene overview

LXL04_031636

Reference: OH-1004 Chr: Chr07 Coordinates: 8815622-8816877 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · LXL04_031636|LXL04_031636|OH1004|cDNA

ATGAGAGTGGGAAGATTGAAGAGTAGCATAGGACCCATAGCACATCAAGGATGTGTAAATACTATTGCTTGGAACTCAAAACGCTCACTATTGATATCTGGATCTGATGACACCCGTGTAAATGTTTGGAGTTATGAAAGCCGCAAGCTTCTGCAATCCATTGAGAGTGGCCATACTTTAAACATATTCTGTACCAAGTTTGTTCCTGAAACATGTGATGATTTGTTAGCATCTGGAGCTGCTGATACTAAAGTTCGATT...

CDS

Download CDS FASTA

474 bp · LXL04_031636|LXL04_031636|OH1004|CDS

ATGAGAGTGGGAAGATTGAAGAGTAGCATAGGACCCATAGCACATCAAGGATGTGTAAATACTATTGCTTGGAACTCAAAACGCTCACTATTGATATCTGGATCTGATGACACCCGTGTAAATGTTTGGAGTTATGAAAGCCGCAAGCTTCTGCAATCCATTGAGAGTGGCCATACTTTAAACATATTCTGTACCAAGTTTGTTCCTGAAACATGTGATGATTTGTTAGCATCTGGAGCTGCTGATACTAAAGTTCGATT...

Protein

Download Protein FASTA

157 aa · LXL04_031636|LXL04_031636|OH1004|PROTEIN

MRVGRLKSSIGPIAHQGCVNTIAWNSKRSLLISGSDDTRVNVWSYESRKLLQSIESGHTLNIFCTKFVPETCDDLLASGAADTKVRLFNLSHTQEDCNITPSALFQCHTRRVEPGNPNVVWSASEDGTLRQHDLREVTSCPPAGECRNILGTRLGPD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031636`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031636

Location Chr07:8815622-8816877 (-)

Description Similar to ASG2: Protein ALTERED SEED GERMINATION 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10940`	May function as a substrate adapter for CUL4-DDB1 E3 ubiquitin-protein ligase complex (Probable).	ASG2 is a farnesylated DWD protein that acts as ABA negative regulator in Arabidopsis.2016 · DOI: 10.1111/pce.12605 Remarkable Evolutionary Conservation of Antiobesity ADIPOSE/WDTC1 Homologs in Animals and Plants.2017 · DOI: 10.1534/genetics.116.198382

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031636 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032869 cellular response to insulin stimulus Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0045717 negative regulation of fatty acid biosynthetic process Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0047484 regulation of response to osmotic stress Biological Process

GO:0055082 intracellular chemical homeostasis Biological Process

KEGG gene cross-reference

ath:AT5G10940

hsa:23038

mmu:230796

mmu:74106

pon:100172900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.512

Rank 1 · LXL04_031636 · OH-1004

Nucleus0.453

Rank 2 · LXL04_031636 · OH-1004

Mitochondrion0.080

Rank 3 · LXL04_031636 · OH-1004

Cell membrane0.058

Rank 4 · LXL04_031636 · OH-1004

Peroxisome0.058

Rank 5 · LXL04_031636 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24807.2WD40_CDC20-Fz13-93 aa

PF25175.2Beta-prop_WDR514-136 aa

PF25173.2Beta-prop_WDR3_1st14-131 aa

PF00400.39WD4014-44 aa

PF25174.2Beta-prop_THOC315-94 aa

PF24814.2WD40_Prp1918-137 aa

PF23381.2Beta-prop_IFT122_1st18-94 aa

PF24817.2WD40_WDHD1_1st19-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031636	`PF24807.2`	WD40_CDC20-Fz	13	93	1.1e-11	45.4
LXL04_031636	`PF25175.2`	Beta-prop_WDR5	14	136	1.3e-17	64.8
LXL04_031636	`PF25173.2`	Beta-prop_WDR3_1st	14	131	2.7e-13	50.7
LXL04_031636	`PF00400.39`	WD40	14	44	2.4e-12	47.5
LXL04_031636	`PF25174.2`	Beta-prop_THOC3	15	94	7.2e-18	65.3
LXL04_031636	`PF24814.2`	WD40_Prp19	18	137	1.9e-11	44.2
LXL04_031636	`PF23381.2`	Beta-prop_IFT122_1st	18	94	1.1e-10	42.0
LXL04_031636	`PF24817.2`	WD40_WDHD1_1st	19	95	3.9e-07	30.3
LXL04_031636	`PF25174.2`	Beta-prop_THOC3	75	136	7.2e-18	65.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BQ3`	Arabidopsis thaliana	Protein ALTERED SEED GERMINATION 2	65.839%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card