LXL04_031503 | RubberDandelionOmics

Gene overview

LXL04_031503

Reference: OH-1004 Chr: Chr07 Coordinates: 6918333-6925716 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1410 bp · LXL04_031503|LXL04_031503|OH1004|cDNA

ATGTGGTTGTATCAATTGCAGATAGTTTTGCTCCAAGTGAAATTTCAACGAGACTTGTTTTATCAAAAGCAAAAGATGTTTTTTCAGGATTCAATCATTCGTGGGGACAGAAGCATTCCACTATACAGTCGAGTTGTTGATGCTGGATCACCAATGGCAATAGTGATTCCTACACGAGGGTCAAACTTTAGCATGAAATTGCGTGATGGTGATGTTTCCTGGCATAATTTTCTTGAAAGAGTTCAAAGCTACAAGAATGT...

CDS

Download CDS FASTA

1410 bp · LXL04_031503|LXL04_031503|OH1004|CDS

ATGTGGTTGTATCAATTGCAGATAGTTTTGCTCCAAGTGAAATTTCAACGAGACTTGTTTTATCAAAAGCAAAAGATGTTTTTTCAGGATTCAATCATTCGTGGGGACAGAAGCATTCCACTATACAGTCGAGTTGTTGATGCTGGATCACCAATGGCAATAGTGATTCCTACACGAGGGTCAAACTTTAGCATGAAATTGCGTGATGGTGATGTTTCCTGGCATAATTTTCTTGAAAGAGTTCAAAGCTACAAGAATGT...

Protein

Download Protein FASTA

469 aa · LXL04_031503|LXL04_031503|OH1004|PROTEIN

MWLYQLQIVLLQVKFQRDLFYQKQKMFFQDSIIRGDRSIPLYSRVVDAGSPMAIVIPTRGSNFSMKLRDGDVSWHNFLERVQSYKNVEFVAVERPIEAFSNILFSSGTTGEPKAIPWTLATPLKAAADGWCHMDIRKGDVVAWPTNLGWMMGPWLVYASLLNGASLALYNGAPLGSGFAKFVQDAKVTMLGVIPSIVRAWRTKNCTTGFDWSTIRCFGSTGEASSVDEYLWLMGRAKYKPVIEYCGGTEIGGGFITGSLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031503`
TK1151 ID	TkA08G110530
OH-1004 ID	LXL04_031503
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 61.157 / OH-1004 94.670 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031503

Location Chr07:6918333-6925716 (-)

Description Similar to AAE17: Probable acyl-activating enzyme 17, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23050`	May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.	No verified direct reference in this release
`At1g55320`	May be involved in the peroxisomal activation of 2,4- dichlorophenoxybutyric acid (2,4-DB), a precursor of active auxins that inhibit root growth.	Identification of two Arabidopsis genes encoding a peroxisomal oxidoreductase-like protein and an acyl-CoA synthetase-like protein that are required for responses to pro-auxins.2009 · DOI: 10.1007/s11103-008-9431-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031503 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009850 auxin metabolic process Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0019427 acetyl-CoA biosynthetic process from acetate Biological Process

GO:0046949 fatty-acyl-CoA biosynthetic process Biological Process

GO:1901696 cannabinoid biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G55320

ath:AT5G23050

kla:KLLA0_A03333g

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.759

Rank 1 · LXL04_031503 · OH-1004

Mitochondrion0.119

Rank 2 · LXL04_031503 · OH-1004

Cytoplasm0.093

Rank 3 · LXL04_031503 · OH-1004

Endoplasmic reticulum0.065

Rank 4 · LXL04_031503 · OH-1004

Nucleus0.054

Rank 5 · LXL04_031503 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501.35AMP-binding93-298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031503	`PF00501.35`	AMP-binding	93	298	3.9e-22	79.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KBF3`	Arabidopsis thaliana	Probable acyl-activating enzyme 17, peroxisomal	71.205%	Swiss-Prot	strong database homology
`Q84P17`	Arabidopsis thaliana	Probable acyl-activating enzyme 18, peroxisomal	53.303%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card