LXL04_031356 | RubberDandelionOmics

Gene overview

LXL04_031356

Reference: OH-1004 Chr: Chr07 Coordinates: 4920204-4922121 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1525 bp · LXL04_031356|LXL04_031356|OH1004|cDNA

ATGATCCCCATCTCTCCCCCATCAAACGATCTCTTAAATAATTTGCAAAACAAGAAGAAACTCATCAAGATCCATGAAGAAACCAACCACCAACGTCCACCCACACGAAACCCCAAACCTAAGAGACCATTACACAATCGGAAACAAGCTTGGCCAAGGCCAATTCGGCACCACCTATCTCTGCACTGACAAATCCACGGGAACCGATTACGCTTGTAAATCCATCCCCAAAAGGAAACTCTTATGCAAAGACGATTACG...

CDS

Download CDS FASTA

1452 bp · LXL04_031356|LXL04_031356|OH1004|CDS

ATGAAGAAACCAACCACCAACGTCCACCCACACGAAACCCCAAACCTAAGAGACCATTACACAATCGGAAACAAGCTTGGCCAAGGCCAATTCGGCACCACCTATCTCTGCACTGACAAATCCACGGGAACCGATTACGCTTGTAAATCCATCCCCAAAAGGAAACTCTTATGCAAAGACGATTACGATGACGTATGGAGGGAGATTCAAATAATGCATCATTTATCCGAAAACCCATGTGTTGTACGAATCAAAGGGAC...

Protein

Download Protein FASTA

483 aa · LXL04_031356|LXL04_031356|OH1004|PROTEIN

MKKPTTNVHPHETPNLRDHYTIGNKLGQGQFGTTYLCTDKSTGTDYACKSIPKRKLLCKDDYDDVWREIQIMHHLSENPCVVRIKGTYEDNVFVHLVMELCTGGELLDRIVDKGWCSERQAAKFIKTVVEVVVACHSMGVMHRDLKPENFLFDSREENAQLKAIDFGLSIFYKPGEYLCDVVGSPYYVAPEVLHKHYGPEIDVWSAGVILYILLCGIPPFWAETDSGIFKTILTGELDFESEPWPHITDEAKDLIKKMLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031356`
TK1151 ID	TkA08G102870
OH-1004 ID	LXL04_031356
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 84.047 / OH-1004 44.720 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031356

Location Chr07:4920204-4922121 (-)

Description Similar to CPK11: Calcium-dependent protein kinase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35670`	May play a role in signal transduction pathways that involve calcium as a second messenger.	Two calcium-dependent protein kinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050666 Two genes that encode Ca(2+)-dependent protein kinases are induced by drought and high-salt stresses in Arabidopsis thaliana.1994 · DOI: 10.1007/bf00286684
`At4g09570`	May play a role in signal transduction pathways that involve calcium as a second messenger.	A novel yeast two-hybrid approach to identify CDPK substrates: characterization of the interaction between AtCPK11 and AtDi19, a nuclear zinc finger protein.2006 · DOI: 10.1016/j.febslet.2006.01.013 Two calcium-dependent protein kinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050666

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0171500`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	No verified direct reference in this release
`Os12g0169800`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031356 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G35670

ath:AT4G09570

dosa:Os11g0171500

dosa:Os12g0169800

gmx:547825

osa:4349899

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · LXL04_031356 · OH-1004

Nucleus0.316

Rank 2 · LXL04_031356 · OH-1004

Cell membrane0.231

Rank 3 · LXL04_031356 · OH-1004

Golgi apparatus0.076

Rank 4 · LXL04_031356 · OH-1004

Lysosome / Vacuole0.061

Rank 5 · LXL04_031356 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase20-278 aa

PF07714.24PK_Tyr_Ser-Thr22-272 aa

PF13499.13EF-hand_7326-386 aa

PF00036.39EF-hand_1326-351 aa

PF13405.13EF-hand_6326-354 aa

PF13202.13EF-hand_5326-348 aa

PF00036.39EF-hand_1361-385 aa

PF13499.13EF-hand_7395-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031356	`PF00069.32`	Pkinase	20	278	1.3e-76	258.2
LXL04_031356	`PF07714.24`	PK_Tyr_Ser-Thr	22	272	8.6e-25	88.2
LXL04_031356	`PF13499.13`	EF-hand_7	326	386	4.2e-31	107.8
LXL04_031356	`PF00036.39`	EF-hand_1	326	351	9.2e-31	103.8
LXL04_031356	`PF13405.13`	EF-hand_6	326	354	3.6e-27	92.1
LXL04_031356	`PF13202.13`	EF-hand_5	326	348	6.4e-22	76.7
LXL04_031356	`PF00036.39`	EF-hand_1	361	385	9.2e-31	103.8
LXL04_031356	`PF13499.13`	EF-hand_7	395	457	4.2e-31	107.8
LXL04_031356	`PF13405.13`	EF-hand_6	398	426	3.6e-27	92.1
LXL04_031356	`PF00036.39`	EF-hand_1	400	424	9.2e-31	103.8
LXL04_031356	`PF12763.14`	EH	401	457	1.5e-07	32.0
LXL04_031356	`PF00036.39`	EF-hand_1	432	458	9.2e-31	103.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39016`	Arabidopsis thaliana	Calcium-dependent protein kinase 11	72.443%	Swiss-Prot	strong database homology
`Q38869`	Arabidopsis thaliana	Calcium-dependent protein kinase 4	72.234%	Swiss-Prot	strong database homology
`Q53P85`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 24	71.279%	Swiss-Prot	strong database homology
`Q2QX45`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 28	72.848%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card