LXL04_031305 | RubberDandelionOmics

Gene overview

LXL04_031305

Reference: OH-1004 Chr: Chr07 Coordinates: 4397197-4400500 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1347 bp · LXL04_031305|LXL04_031305|OH1004|cDNA

ATGGCCCCTGGTGGACTCCCTTACTTTGACCCCGAATATGAAAGCTTAAGCATCAGAATTAACCCTCCTAGGGTTTCTGTCGATAACCATACTTGCGTTGACTGTACTTTAGTCAAGGTAGACAGTGTAAACAAACCAGGAATACTGCTGGAAGTTGTCCAAATTTTAGCAGACCTCGATCTCATTATTACTAAAGCTTACATTTCCTCTGATGGCGGATGGTTCATGGATGTGTTTCATGTTACGGATCAACAAGGAAA...

CDS

Download CDS FASTA

1347 bp · LXL04_031305|LXL04_031305|OH1004|CDS

ATGGCCCCTGGTGGACTCCCTTACTTTGACCCCGAATATGAAAGCTTAAGCATCAGAATTAACCCTCCTAGGGTTTCTGTCGATAACCATACTTGCGTTGACTGTACTTTAGTCAAGGTAGACAGTGTAAACAAACCAGGAATACTGCTGGAAGTTGTCCAAATTTTAGCAGACCTCGATCTCATTATTACTAAAGCTTACATTTCCTCTGATGGCGGATGGTTCATGGATGTGTTTCATGTTACGGATCAACAAGGAAA...

Protein

Download Protein FASTA

448 aa · LXL04_031305|LXL04_031305|OH1004|PROTEIN

MAPGGLPYFDPEYESLSIRINPPRVSVDNHTCVDCTLVKVDSVNKPGILLEVVQILADLDLIITKAYISSDGGWFMDVFHVTDQQGNKITDKMTIDYIEKALGPKGHTSDERKTWPAKRVGVHTMGDYTAIELVGRDRPGLLSEISAVIANLKINVAAAEVWTHNTKIACVVYLNGDTTTRGVDDPTRLSTMEEQLKNILRVCGDDDKVAHTNFSMGLTHIDRRLHQMLFAEMDYERKGLKNEADCAAFLELKISVDRCA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031305`
TK1151 ID	TkA08G100800
OH-1004 ID	LXL04_031305
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031305

Location Chr07:4397197-4400500 (+)

Description Similar to ACR3: ACT domain-containing protein ACR3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76990`	May bind amino acids.	Molecular characterization of a novel gene family encoding ACT domain repeat proteins in Arabidopsis.2002 · DOI: 10.1104/pp.007484
`At1g69040`	May bind amino acids.	No verified direct reference in this release
`At2g03730`	May bind amino acids.	No verified direct reference in this release
`At5g25320`	May bind amino acids.	No verified direct reference in this release
`At3g01990`	May bind amino acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031305 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006521 regulation of amino acid metabolic process Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016597 amino acid binding Molecular Function

KEGG gene cross-reference

ath:AT1G69040

ath:AT1G76990

ath:AT2G03730

ath:AT3G01990

ath:AT5G25320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · LXL04_031305 · OH-1004

Nucleus0.396

Rank 2 · LXL04_031305 · OH-1004

Cell membrane0.170

Rank 3 · LXL04_031305 · OH-1004

Lysosome / Vacuole0.053

Rank 4 · LXL04_031305 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_031305 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24931.2ACT_ACR9_3rd25-96 aa

PF26956.1ACT_ACR_D132-105 aa

PF24914.2ACR10_N34-92 aa

PF01842.32ACT37-86 aa

PF13291.13ACT_4129-164 aa

PF01842.32ACT130-197 aa

PF24931.2ACT_ACR9_3rd254-337 aa

PF01842.32ACT266-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031305	`PF24931.2`	ACT_ACR9_3rd	25	96	3.3e-17	63.1
LXL04_031305	`PF26956.1`	ACT_ACR_D1	32	105	3.2e-52	175.0
LXL04_031305	`PF24914.2`	ACR10_N	34	92	5e-15	55.4
LXL04_031305	`PF01842.32`	ACT	37	86	7.9e-38	128.5
LXL04_031305	`PF13291.13`	ACT_4	129	164	2.5e-13	51.2
LXL04_031305	`PF01842.32`	ACT	130	197	7.9e-38	128.5
LXL04_031305	`PF24931.2`	ACT_ACR9_3rd	254	337	3.3e-17	63.1
LXL04_031305	`PF01842.32`	ACT	266	308	7.9e-38	128.5
LXL04_031305	`PF01842.32`	ACT	345	404	7.9e-38	128.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49285`	Arabidopsis thaliana	ACT domain-containing protein ACR3	68.502%	Swiss-Prot	strong database homology
`Q8LJW3`	Arabidopsis thaliana	ACT domain-containing protein ACR4	53.425%	Swiss-Prot	strong database homology
`Q9ZPQ8`	Arabidopsis thaliana	ACT domain-containing protein ACR5	50.448%	Swiss-Prot	strong database homology
`F4JWR0`	Arabidopsis thaliana	ACT domain-containing protein ACR2	45.625%	Swiss-Prot	moderate database homology
`Q9SGA0`	Arabidopsis thaliana	ACT domain-containing protein ACR6	51.238%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card