LXL04_031277 | RubberDandelionOmics

Gene overview

LXL04_031277

Reference: OH-1004 Chr: Chr07 Coordinates: 3886573-3893757 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3135 bp · LXL04_031277|LXL04_031277|OH1004|cDNA

ATGGAAAGATACACAACTGGAAATAAAAGGTTAAAACAAGAAAAACTGAAATTCAACCAAAACACTTCTCGAATCCAAACTgaaaaaaacaaatacaaaataCACGGTTTAAAAATAGTTTTCCCCTCAAACCGAAAACCTCAAACATTTCACTACGCGCAAAGAGAACCCTTTCCCGCCTACGACTCAAAGAAAAAGCACATCACCCAATCCACCCATCTTATTCAAACGATTTCTTTCTCAGATTCAGGATTGGATCC...

CDS

Download CDS FASTA

3135 bp · LXL04_031277|LXL04_031277|OH1004|CDS

ATGGAAAGATACACAACTGGAAATAAAAGGTTAAAACAAGAAAAACTGAAATTCAACCAAAACACTTCTCGAATCCAAACTGAAAAAAACAAATACAAAATACACGGTTTAAAAATAGTTTTCCCCTCAAACCGAAAACCTCAAACATTTCACTACGCGCAAAGAGAACCCTTTCCCGCCTACGACTCAAAGAAAAAGCACATCACCCAATCCACCCATCTTATTCAAACGATTTCTTTCTCAGATTCAGGATTGGATCC...

Protein

Download Protein FASTA

1044 aa · LXL04_031277|LXL04_031277|OH1004|PROTEIN

MERYTTGNKRLKQEKLKFNQNTSRIQTEKNKYKIHGLKIVFPSNRKPQTFHYAQREPFPAYDSKKKHITQSTHLIQTISFSDSGLDPRVGGEIIEEMMRKTTFKGANVFMSRNLVPPEIFASLHDVLKENGAEIFLCCDPSRNGPNDYHIISSRDHEKFNDLRQKGCNLLGMAVSLPFQLLVPFSGPQCVFFCAKENRVLPKQGFTCCLAMDGIKIVASGFEKEGKDEIHKLVTAMGGLLETKASSDISFVIVKNVLAAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031277`
TK1151 ID	TkA08G099150
OH-1004 ID	LXL04_031277
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 96.360 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_031277`
Location	Chr07:3886573-3893757 (-)
Description	Similar to TOPBP1: DNA topoisomerase 2-binding protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031277` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000076 DNA replication checkpoint signaling Biological Process GO:0000077 DNA damage checkpoint signaling Biological Process GO:0000281 mitotic cytokinesis Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006259 DNA metabolic process Biological Process GO:0006270 DNA replication initiation Biological Process GO:0006277 DNA amplification Biological Process GO:0006281 DNA repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0006974 DNA damage response Biological Process GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process GO:0007131 reciprocal meiotic recombination Biological Process
KEGG gene cross-reference	hsa:11073 hsa:1894 mmu:235559 xla:398573 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · LXL04_031277 · OH-1004

Cytoplasm0.120

Rank 2 · LXL04_031277 · OH-1004

Cell membrane0.026

Rank 3 · LXL04_031277 · OH-1004

Mitochondrion0.014

Rank 4 · LXL04_031277 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_031277 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00533.34BRCT211-282 aa

PF12738.14PTCB-BRCT215-277 aa

PF00533.34BRCT295-364 aa

PF16589.13BRCT_2298-375 aa

PF12738.14PTCB-BRCT301-359 aa

PF00533.34BRCT479-554 aa

PF00533.34BRCT739-809 aa

PF16589.13BRCT_2739-820 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031277	`PF00533.34`	BRCT	211	282	1.6e-52	176.3
LXL04_031277	`PF12738.14`	PTCB-BRCT	215	277	3.4e-50	168.6
LXL04_031277	`PF00533.34`	BRCT	295	364	1.6e-52	176.3
LXL04_031277	`PF16589.13`	BRCT_2	298	375	2.1e-31	108.8
LXL04_031277	`PF12738.14`	PTCB-BRCT	301	359	3.4e-50	168.6
LXL04_031277	`PF00533.34`	BRCT	479	554	1.6e-52	176.3
LXL04_031277	`PF00533.34`	BRCT	739	809	1.6e-52	176.3
LXL04_031277	`PF16589.13`	BRCT_2	739	820	2.1e-31	108.8
LXL04_031277	`PF12738.14`	PTCB-BRCT	743	804	3.4e-50	168.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card