LXL04_031254 | RubberDandelionOmics

Gene overview

LXL04_031254

Reference: OH-1004 Chr: Chr07 Coordinates: 3315247-3317644 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

720 bp · LXL04_031254|LXL04_031254|OH1004|cDNA

ATGAAACGAAGAAGAGAAATGGAGAAACAATGCTCTTCAGAGTTAAGATCCACCATCGATGAGCTTTCTTTGTTAGTTGTCATGAAGCTTaaacatcatcatcatcatcatcttcatcatgaTAGCGATCCTGTTGCTGCAGATGATCTGCCAAATAACACTCATATCCCCACCAAACCCTTCCTTTCTATCTGCAGTTTTCTTCTCCATCTTCTTGATAAGATAGGGCCAACAATGGCAGTTTTGAGACAAGACGTCCA...

CDS

Download CDS FASTA

720 bp · LXL04_031254|LXL04_031254|OH1004|CDS

ATGAAACGAAGAAGAGAAATGGAGAAACAATGCTCTTCAGAGTTAAGATCCACCATCGATGAGCTTTCTTTGTTAGTTGTCATGAAGCTTAAACATCATCATCATCATCATCTTCATCATGATAGCGATCCTGTTGCTGCAGATGATCTGCCAAATAACACTCATATCCCCACCAAACCCTTCCTTTCTATCTGCAGTTTTCTTCTCCATCTTCTTGATAAGATAGGGCCAACAATGGCAGTTTTGAGACAAGACGTCCA...

Protein

Download Protein FASTA

239 aa · LXL04_031254|LXL04_031254|OH1004|PROTEIN

MKRRREMEKQCSSELRSTIDELSLLVVMKLKHHHHHHLHHDSDPVAADDLPNNTHIPTKPFLSICSFLLHLLDKIGPTMAVLRQDVQRNILRLEKMHESDPVLYSNVVEILKKEASEGTSRKITSCSKAFVWLTRSLDFTATFLDLIGNDLEVNIEEAVKDAYEATLKPWHGWISSTAYRVALKLVPDNKTLIGILISEAKDRETLIDELKSLTSLLAPFLNELHTVLETYELHKIKAT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031254`
TK1151 ID	TkA08G097340
OH-1004 ID	LXL04_031254
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031254

Location Chr07:3315247-3317644 (+)

Description Similar to GLTP2: Glycolipid transfer protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21360`	Transfers glycolipids in vitro.	No verified direct reference in this release
`At3g21260`	May be involved in glycolipids transfer.	No verified direct reference in this release
`At2g33470`	May be involved in glycolipids transfer.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031254 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001576 globoside biosynthetic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0015031 protein transport Biological Process

GO:0035621 ER to Golgi ceramide transport Biological Process

GO:0035627 ceramide transport Biological Process

GO:0120009 intermembrane lipid transfer Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G21360

ath:AT2G33470

ath:AT3G21260

mmu:231999

rno:500132

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.738

Rank 1 · LXL04_031254 · OH-1004

Nucleus0.276

Rank 2 · LXL04_031254 · OH-1004

Cell membrane0.106

Rank 3 · LXL04_031254 · OH-1004

Golgi apparatus0.066

Rank 4 · LXL04_031254 · OH-1004

Endoplasmic reticulum0.056

Rank 5 · LXL04_031254 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08718.17GLTP56-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031254	`PF08718.17`	GLTP	56	195	2e-38	132.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLQ3`	Arabidopsis thaliana	Glycolipid transfer protein 2	46.444%	Swiss-Prot	moderate database homology
`Q9LU33`	Arabidopsis thaliana	Glycolipid transfer protein 3	48.148%	Swiss-Prot	moderate database homology
`O22797`	Arabidopsis thaliana	Glycolipid transfer protein 1	31.148%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card