LXL04_031180 | RubberDandelionOmics

Gene overview

LXL04_031180

Reference: OH-1004 Chr: Chr07 Coordinates: 1899380-1900498 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · LXL04_031180|LXL04_031180|OH1004|cDNA

ATGTCCCAACTCAAGTCCTCGTCGTCATGGATATCTTCCGATCACCGGATTCACAGTTCCAATAATATATTTCTTCAGCATCATCGGAACTTATTTCAATCCAATGTCTCTCACCCTTCAACGTTACCAAATTTCCCTTCAATTTGCTGCAATCTTCGTGACCTCCGCCAACGTATTGCCACCGTGAAAAACACACAGAAGATAACAGAAGCAATGAAGCTGGTAGCAGCTGCGAAGGTCCGGCGAGCCCAAGAAGCAGT...

CDS

Download CDS FASTA

1119 bp · LXL04_031180|LXL04_031180|OH1004|CDS

ATGTCCCAACTCAAGTCCTCGTCGTCATGGATATCTTCCGATCACCGGATTCACAGTTCCAATAATATATTTCTTCAGCATCATCGGAACTTATTTCAATCCAATGTCTCTCACCCTTCAACGTTACCAAATTTCCCTTCAATTTGCTGCAATCTTCGTGACCTCCGCCAACGTATTGCCACCGTGAAAAACACACAGAAGATAACAGAAGCAATGAAGCTGGTAGCAGCTGCGAAGGTCCGGCGAGCCCAAGAAGCAGT...

Protein

Download Protein FASTA

372 aa · LXL04_031180|LXL04_031180|OH1004|PROTEIN

MSQLKSSSSWISSDHRIHSSNNIFLQHHRNLFQSNVSHPSTLPNFPSICCNLRDLRQRIATVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSEALIDVLYSINQQCQLEDVDIPLTTVRPVKKVALVVITGDRGLCGGFNNMILRKAETRIAELKNLGLDYTVISVGKKGNSYFLGRPSVSVDRFVEGVGFPTAKDSQVIADDVFSLFVSEEVDKVELMYTKFVSLIKSNTVIQTLLPLSAKGEVIDGNGNSVDASED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031180`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031180

Location Chr07:1899380-1900498 (-)

Description Similar to ATPC: ATP synthase gamma chain, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04640`	Produces ATP from ADP in the presence of a proton gradient across the membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031180 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006754 ATP biosynthetic process Biological Process

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0045259 proton-transporting ATP synthase complex Cellular Component

GO:0030234 enzyme regulator activity Molecular Function

GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Molecular Function

KEGG gene cross-reference

ath:AT4G04640

nta:107813955

zma:100284505

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_031180 · OH-1004

Mitochondrion0.034

Rank 2 · LXL04_031180 · OH-1004

Cytoplasm0.015

Rank 3 · LXL04_031180 · OH-1004

Nucleus0.013

Rank 4 · LXL04_031180 · OH-1004

Peroxisome0.011

Rank 5 · LXL04_031180 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00231.25ATP-synt51-371 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031180	`PF00231.25`	ATP-synt	51	371	6.2e-91	305.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q01908`	Arabidopsis thaliana	ATP synthase gamma chain 1, chloroplastic	71.856%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card