LXL04_031077 | RubberDandelionOmics

Gene overview

LXL04_031077

Reference: OH-1004 Chr: Chr07 Coordinates: 89450-90439 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

660 bp · LXL04_031077|LXL04_031077|OH1004|cDNA

ATGGTTGTCACTCATGGAACCATCCATCCCCTTATCGCTCAACATTATCCTTCATCCAAATCACACCACACCTCCCATTTATTGGTCTCCTGTGGGTTTTTTAGGGTAGCCATGGCATTTGCAGGTACAACCCAGAAATGCATGGCATGTGACAAGATCGTGTACCTGGTGGACAAACTTACAGCTGATAATCGTATCTTTCACAAAGCTTGCTTCAGATGCCACCATTGCAATGGCACCCTCAAGCTCAGCAACTACAA...

CDS

Download CDS FASTA

660 bp · LXL04_031077|LXL04_031077|OH1004|CDS

ATGGTTGTCACTCATGGAACCATCCATCCCCTTATCGCTCAACATTATCCTTCATCCAAATCACACCACACCTCCCATTTATTGGTCTCCTGTGGGTTTTTTAGGGTAGCCATGGCATTTGCAGGTACAACCCAGAAATGCATGGCATGTGACAAGATCGTGTACCTGGTGGACAAACTTACAGCTGATAATCGTATCTTTCACAAAGCTTGCTTCAGATGCCACCATTGCAATGGCACCCTCAAGCTCAGCAACTACAA...

Protein

Download Protein FASTA

219 aa · LXL04_031077|LXL04_031077|OH1004|PROTEIN

MVVTHGTIHPLIAQHYPSSKSHHTSHLLVSCGFFRVAMAFAGTTQKCMACDKIVYLVDKLTADNRIFHKACFRCHHCNGTLKLSNYNSFEGVLYCRPHFDQLFKKTGSLDKSFEGTPKIVKPQKSIDGEKPMASKVSSMFVGTRDKCLGCKNTVYPTEKVSVNGIAYHKSCFKCSHGGCVISPSNYIAHEGRLYCRHHHTQLIREKGNLSQLEGDRPAP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031077`
TK1151 ID	TkAUNG097020
OH-1004 ID	LXL04_031077
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031077

Location Chr07:89450-90439 (-)

Description Similar to WLIM1: LIM domain-containing protein WLIM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10200`	Binds to actin filaments and promotes cross-linking into thick bundles.	Arabidopsis LIM proteins: a family of actin bundlers with distinct expression patterns and modes of regulation.2010 · DOI: 10.1105/tpc.110.075960
`At2g39900`	Binds to actin filaments and promotes cross-linking into thick bundles.	No verified direct reference in this release
`At3g55770`	Binds to actin filaments and promotes cross-linking into thick bundles.	Arabidopsis LIM proteins: a family of actin bundlers with distinct expression patterns and modes of regulation.2010 · DOI: 10.1105/tpc.110.075960
`At3g61230`	Binds to actin filaments and promotes cross-linking into thick bundles.	Arabidopsis LIM proteins: a family of actin bundlers with distinct expression patterns and modes of regulation.2010 · DOI: 10.1105/tpc.110.075960

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031077 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0051017 actin filament bundle assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G10200

ath:AT2G39900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.694

Rank 1 · LXL04_031077 · OH-1004

Nucleus0.291

Rank 2 · LXL04_031077 · OH-1004

Cell membrane0.086

Rank 3 · LXL04_031077 · OH-1004

Golgi apparatus0.054

Rank 4 · LXL04_031077 · OH-1004

Mitochondrion0.051

Rank 5 · LXL04_031077 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00412.29LIM47-102 aa

PF00412.29LIM147-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031077	`PF00412.29`	LIM	47	102	5.1e-21	75.4
LXL04_031077	`PF00412.29`	LIM	147	201	5.1e-21	75.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JX5`	Arabidopsis thaliana	LIM domain-containing protein WLIM1	81.921%	Swiss-Prot	strong database homology
`O04193`	Arabidopsis thaliana	LIM domain-containing protein WLIM2a	56.497%	Swiss-Prot	strong database homology
`Q9M047`	Arabidopsis thaliana	LIM domain-containing protein WLIM2b	55.307%	Swiss-Prot	strong database homology
`Q500W4`	Arabidopsis thaliana	LIM domain-containing protein PLIM2c	51.149%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card