LXL04_031044 | RubberDandelionOmics

Gene overview

LXL04_031044

Reference: OH-1004 Chr: Chr06 Coordinates: 127192533-127193848 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · LXL04_031044|LXL04_031044|OH1004|cDNA

ATGGACCAAGTGAGAACTGCAATTGAAGTTGAAAAGGTTCAAATACTTCCTGCAgaaaatgatgaccatggaGGTGTAGTGGTAAAGCTGGAGGAGCATATGGACTCTGATGTCTTTCTCACACTCCTTAAAACATCAATGTCACAATGGACAATTCAGGGCAAGAAGGGTGTTTGGATTAAACTGCCTACTCATCTTGTAAATCTTGTTGAACCTGCAGTGAAGGAGGGTTTTTGCTATCACCATGCTGAAAGCGATTA...

CDS

Download CDS FASTA

819 bp · LXL04_031044|LXL04_031044|OH1004|CDS

ATGGACCAAGTGAGAACTGCAATTGAAGTTGAAAAGGTTCAAATACTTCCTGCAGAAAATGATGACCATGGAGGTGTAGTGGTAAAGCTGGAGGAGCATATGGACTCTGATGTCTTTCTCACACTCCTTAAAACATCAATGTCACAATGGACAATTCAGGGCAAGAAGGGTGTTTGGATTAAACTGCCTACTCATCTTGTAAATCTTGTTGAACCTGCAGTGAAGGAGGGTTTTTGCTATCACCATGCTGAAAGCGATTA...

Protein

Download Protein FASTA

272 aa · LXL04_031044|LXL04_031044|OH1004|PROTEIN

MDQVRTAIEVEKVQILPAENDDHGGVVVKLEEHMDSDVFLTLLKTSMSQWTIQGKKGVWIKLPTHLVNLVEPAVKEGFCYHHAESDYLMLVKWIPKTTNTIPANASHRVGVGAVVLNHKREMLVVQEKNGILRGKGIWKIPTGVIDVGEELFDGAKREVKEETGIDTEFVEILAFRQSHKVYFEKSDLFFVCMMRPLSFDIQIQELEIEAAKWMPLEEVAAQPSAEKESLLKYITDLCIAKVERDYSGFSPHPVTSFFSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031044`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031044

Location Chr06:127192533-127193848 (-)

Description Similar to NUDT2: Nudix hydrolase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47650`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	Comprehensive analysis of cytosolic Nudix hydrolases in Arabidopsis thaliana.2005 · DOI: 10.1074/jbc.m503536200 Overexpression of an ADP-ribose pyrophosphatase, AtNUDX2, confers enhanced tolerance to oxidative stress in Arabidopsis plants.2009 · DOI: 10.1111/j.1365-313x.2008.03686.x
`At4g25434`	May mediate the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release
`At4g12720`	Mediates the hydrolysis of some nucleoside diphosphate derivatives.	Analysis of Arabidopsis growth factor gene 1 (GFG1) encoding a nudix hydrolase during oxidative signaling.2006 · DOI: 10.1007/s00425-005-0183-y Salicylic acid-independent ENHANCED DISEASE SUSCEPTIBILITY1 signaling in Arabidopsis immunity and cell death is regulated by the monooxygenase FMO1 and the Nudix hydrolase NUDT7.2006 · DOI: 10.1105/tpc.105.039982 AtNUDT7, a negative regulator of basal immunity in Arabidopsis, modulates two distinct defense response pathways and is involved in maintaining redox homeostasis.2007 · DOI: 10.1104/pp.107.103374
`At5g47240`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives (By similarity).	Functional characterization of a Nudix hydrolase AtNUDX8 upon pathogen attack indicates a positive role in plant immune responses.2014 · DOI: 10.1371/journal.pone.0114119
`At2g04450`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031044 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010193 response to ozone Biological Process

GO:0010581 regulation of starch biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051707 response to other organism Biological Process

GO:0070212 protein poly-ADP-ribosylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0080151 positive regulation of salicylic acid mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT2G04450

ath:AT4G12720

ath:AT4G25434

ath:AT5G47240

ath:AT5G47650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.720

Rank 1 · LXL04_031044 · OH-1004

Nucleus0.324

Rank 2 · LXL04_031044 · OH-1004

Mitochondrion0.092

Rank 3 · LXL04_031044 · OH-1004

Peroxisome0.066

Rank 4 · LXL04_031044 · OH-1004

Cell membrane0.049

Rank 5 · LXL04_031044 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18290.8Nudix_hydro16-94 aa

PF00293.35NUDIX107-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031044	`PF18290.8`	Nudix_hydro	16	94	4e-28	98.0
LXL04_031044	`PF00293.35`	NUDIX	107	224	4.1e-22	79.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94B74`	Arabidopsis thaliana	Nudix hydrolase 2	58.621%	Swiss-Prot	strong database homology
`Q6NPD7`	Arabidopsis thaliana	Nudix hydrolase 10	59.480%	Swiss-Prot	strong database homology
`Q9SU14`	Arabidopsis thaliana	Nudix hydrolase 7	50.958%	Swiss-Prot	strong database homology
`Q8L7W2`	Arabidopsis thaliana	Nudix hydrolase 8	51.711%	Swiss-Prot	strong database homology
`Q9SJC4`	Arabidopsis thaliana	Nudix hydrolase 6	49.801%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card