LXL04_031014 | RubberDandelionOmics

Gene overview

LXL04_031014

Reference: OH-1004 Chr: Chr06 Coordinates: 126741288-126742349 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · LXL04_031014|LXL04_031014|OH1004|cDNA

ATGGAAGTCGACGGCGAAGAACTCAAAACCTTTCTCAAAGTATGGGTTCTTGCCATCTCCTCTCTCTGTTACTGCTACTTGATTCCAACTCGGATCTCCAATGGTGTACCGAGGCTCCTCTCTCTACTCCCcgtcatcatcttcttcttcatcctcCCACTCCCTCTCTCCACAGTCCATCTCGCCGGCCCCACCATCTTCTACCTTGTCTGGCTTGGTAATTTCAAACTCCTACTCTTCGCCTTCAACCGTGGCCCTTT...

CDS

Download CDS FASTA

1062 bp · LXL04_031014|LXL04_031014|OH1004|CDS

ATGGAAGTCGACGGCGAAGAACTCAAAACCTTTCTCAAAGTATGGGTTCTTGCCATCTCCTCTCTCTGTTACTGCTACTTGATTCCAACTCGGATCTCCAATGGTGTACCGAGGCTCCTCTCTCTACTCCCCGTCATCATCTTCTTCTTCATCCTCCCACTCCCTCTCTCCACAGTCCATCTCGCCGGCCCCACCATCTTCTACCTTGTCTGGCTTGGTAATTTCAAACTCCTACTCTTCGCCTTCAACCGTGGCCCTTT...

Protein

Download Protein FASTA

353 aa · LXL04_031014|LXL04_031014|OH1004|PROTEIN

MEVDGEELKTFLKVWVLAISSLCYCYLIPTRISNGVPRLLSLLPVIIFFFILPLPLSTVHLAGPTIFYLVWLGNFKLLLFAFNRGPLASDPPLPFSIFISIALLPINPKHKNAVDDIHSSDPVPDSVSVNPSHKHTLLAFKALILAVIVGAYRYQDNLHRYVILGFYCCHVYLGVELVLAITAFFVRFFLGFKFEIEPQFNEPYLATSLQDFWGRRWNLMVTSILRPTVYDPIREISLPVLGKLWSRLPAIFATFVVSGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031014`
TK1151 ID	TkAUNG061090
OH-1004 ID	LXL04_031014
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.700
Protein coverage (%)	TK1151 71.351 / OH-1004 40.227 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031014

Location Chr06:126741288-126742349 (-)

Description Similar to Long-chain-alcohol O-fatty-acyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55380`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release
`At5g55340`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release
`At3g51970`	Involved in the esterification of cycloartenol.	Biosynthesis of phytosterol esters: identification of a sterol o-acyltransferase in Arabidopsis.2007 · DOI: 10.1104/pp.107.106278 Involvement of the phospholipid sterol acyltransferase1 in plant sterol homeostasis and leaf senescence.2010 · DOI: 10.1104/pp.109.145672
`At5g55370`	Catalyzes the final step in the synthesis of long-chain linear esters (waxes).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031014 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0016127 sterol catabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0047196 long-chain-alcohol O-fatty-acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G51970

ath:AT5G55340

ath:AT5G55370

ath:AT5G55380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.787

Rank 1 · LXL04_031014 · OH-1004

Cell membrane0.073

Rank 2 · LXL04_031014 · OH-1004

Golgi apparatus0.066

Rank 3 · LXL04_031014 · OH-1004

Nucleus0.063

Rank 4 · LXL04_031014 · OH-1004

Cytoplasm0.053

Rank 5 · LXL04_031014 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13813.12MBOAT_2197-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031014	`PF13813.12`	MBOAT_2	197	283	4.8e-20	72.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ72`	Arabidopsis thaliana	Probable long-chain-alcohol O-fatty-acyltransferase 1	49.857%	Swiss-Prot	moderate database homology
`Q9FJ76`	Arabidopsis thaliana	Probable long-chain-alcohol O-fatty-acyltransferase 5	48.295%	Swiss-Prot	moderate database homology
`Q9SV07`	Arabidopsis thaliana	Acyl-CoA--sterol O-acyltransferase 1	45.773%	Swiss-Prot	moderate database homology
`Q9FJ73`	Arabidopsis thaliana	Probable long-chain-alcohol O-fatty-acyltransferase 2	44.915%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card