LXL04_030730 | RubberDandelionOmics

Gene overview

LXL04_030730

Reference: OH-1004 Chr: Chr06 Coordinates: 121543279-121545312 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · LXL04_030730|LXL04_030730|OH1004|cDNA

ATGGCGATGCAGATGGCAAGAGTAGGAGATCGTGGATTCAGGGATAAAATGGCGGAACTTCGACTGATTTCCGACAAAGAAATTGAGATTCAGGAGCGGAGGATTGAAACTTCCGCTCTTTCATTGCGTAAATCCCTTCAGTCAATCAAGTCCGGTGCCCAGGAAACCGTGTTAAATCAAGAGAAGATAGGAAAGCTCAAATCTCAACTGAGGGCAGTGGAGGATCATTTGGTGAAAGCTCTTTCTGTAAAGACACGTAA...

CDS

Download CDS FASTA

993 bp · LXL04_030730|LXL04_030730|OH1004|CDS

ATGGCGATGCAGATGGCAAGAGTAGGAGATCGTGGATTCAGGGATAAAATGGCGGAACTTCGACTGATTTCCGACAAAGAAATTGAGATTCAGGAGCGGAGGATTGAAACTTCCGCTCTTTCATTGCGTAAATCCCTTCAGTCAATCAAGTCCGGTGCCCAGGAAACCGTGTTAAATCAAGAGAAGATAGGAAAGCTCAAATCTCAACTGAGGGCAGTGGAGGATCATTTGGTGAAAGCTCTTTCTGTAAAGACACGTAA...

Protein

Download Protein FASTA

330 aa · LXL04_030730|LXL04_030730|OH1004|PROTEIN

MAMQMARVGDRGFRDKMAELRLISDKEIEIQERRIETSALSLRKSLQSIKSGAQETVLNQEKIGKLKSQLRAVEDHLVKALSVKTRKEAKKMAIADSISATKARLEEHKKIVVDQRTRKDEFAEIISQQSEALKEIEEKHKQDAECREEIEEAISWYNTVLGFRIETGPGIKFIFNNINKKNLKEEYYFTIRLENDIYSLLDCHPNVSDTKMLIQELNATNGLYKFVRSMRAKFQEFAVIGNLGENAQETCTVSMSAPFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030730`
TK1151 ID	TkA07G426550
OH-1004 ID	LXL04_030730
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.010 / OH-1004 90.909 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030730

Location Chr06:121543279-121545312 (+)

Description Similar to SPC25: Kinetochore protein SPC25 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48210`	Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity to ensure proper cell division.	MUN (MERISTEM UNSTRUCTURED), encoding a SPC24 homolog of NDC80 kinetochore complex, affects development through cell division in Arabidopsis thaliana.2018 · DOI: 10.1111/tpj.13823

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030730 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0008608 attachment of spindle microtubules to kinetochore Biological Process

GO:0051301 cell division Biological Process

GO:0051455 spindle attachment to meiosis I kinetochore Biological Process

GO:1990571 meiotic centromere clustering Biological Process

GO:0000776 kinetochore Cellular Component

GO:0000779 condensed chromosome, centromeric region Cellular Component

GO:0000940 outer kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0031262 Ndc80 complex Cellular Component

KEGG gene cross-reference

ath:AT3G48210

spo:2539200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.880

Rank 1 · LXL04_030730 · OH-1004

Cytoplasm0.184

Rank 2 · LXL04_030730 · OH-1004

Mitochondrion0.028

Rank 3 · LXL04_030730 · OH-1004

Cell membrane0.022

Rank 4 · LXL04_030730 · OH-1004

Golgi apparatus0.012

Rank 5 · LXL04_030730 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08234.18Spindle_Spc25170-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030730	`PF08234.18`	Spindle_Spc25	170	235	8.8e-21	74.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VK9`	Arabidopsis thaliana	Kinetochore protein SPC25 homolog	39.869%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card