LXL04_030634 | RubberDandelionOmics

Gene overview

LXL04_030634

Reference: OH-1004 Chr: Chr06 Coordinates: 119926976-119928376 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1401 bp · LXL04_030634|LXL04_030634|OH1004|cDNA

ATGGCCTCCGTCGCTCTCAAATCCTTCGTCGGACTCCGCCAAACATCGACGGAAAAACACCATTCCTCCATCACCAGTCTCTCTAAGCCCCTTTCATCCAGTCAGATCCATTACCGTCGCCTTAATGTCGTCGCCGGTAAGTCCAGCCCCAAAATCACTGGCCGTAATCTCCGCGTCGCTGTCATCGGAGGTGGTCCTGCAGGCGGAGCAGCTGCAGAAACCCTAGCGAAAGGCGGAATTGAGACGATTTTGATCGAACG...

CDS

Download CDS FASTA

1401 bp · LXL04_030634|LXL04_030634|OH1004|CDS

ATGGCCTCCGTCGCTCTCAAATCCTTCGTCGGACTCCGCCAAACATCGACGGAAAAACACCATTCCTCCATCACCAGTCTCTCTAAGCCCCTTTCATCCAGTCAGATCCATTACCGTCGCCTTAATGTCGTCGCCGGTAAGTCCAGCCCCAAAATCACTGGCCGTAATCTCCGCGTCGCTGTCATCGGAGGTGGTCCTGCAGGCGGAGCAGCTGCAGAAACCCTAGCGAAAGGCGGAATTGAGACGATTTTGATCGAACG...

Protein

Download Protein FASTA

466 aa · LXL04_030634|LXL04_030634|OH1004|PROTEIN

MASVALKSFVGLRQTSTEKHHSSITSLSKPLSSSQIHYRRLNVVAGKSSPKITGRNLRVAVIGGGPAGGAAAETLAKGGIETILIERKMDNAKPCGGAIPLCMVGEFDLPLDIIDRRVTKMKMISPSNVAVDIGRTLKPHEYIGMVRREVLDAYLRERAAAAGATVINGLFFKMDKPTDKNAPYVLHYNAYDGKAGSAGKRQTIEVDAVIGADGANSRVAKSIDAGDYEYAIAFQERIKIPADKMQYYEDLAEMYVGDDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030634`
TK1151 ID	TkA03G349390
OH-1004 ID	LXL04_030634
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	52.800
Protein coverage (%)	TK1151 99.595 / OH-1004 68.670 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030634

Location Chr06:119926976-119928376 (+)

Description Similar to CHLP: Geranylgeranyl diphosphate reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74470`	Catalyzes the reduction of geranylgeranyl diphosphate to phytyl diphosphate, providing phytol for both tocopherol and chlorophyll synthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0744900`	Catalyzes the reduction of geranylgeranyl diphosphate to phytyl diphosphate, providing phytol for both tocopherol and chlorophyll synthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030634 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0015979 photosynthesis Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0033385 geranylgeranyl diphosphate metabolic process Biological Process

GO:0033521 phytyl diphosphate biosynthetic process Biological Process

GO:0036070 light-independent bacteriochlorophyll biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ag:CAA07683

ath:AT1G74470

dosa:Os02g0744900

nta:107783257

rcp:RCAP_rcc00673

syn:sll1091

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.952

Rank 1 · LXL04_030634 · OH-1004

Mitochondrion0.066

Rank 2 · LXL04_030634 · OH-1004

Cytoplasm0.014

Rank 3 · LXL04_030634 · OH-1004

Cell membrane0.012

Rank 4 · LXL04_030634 · OH-1004

Nucleus0.011

Rank 5 · LXL04_030634 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01494.26FAD_binding_358-90 aa

PF07992.21Pyr_redox_258-220 aa

PF01494.26FAD_binding_3136-347 aa

PF22578.3GGR_cat245-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030634	`PF01494.26`	FAD_binding_3	58	90	6.6e-12	46.0
LXL04_030634	`PF07992.21`	Pyr_redox_2	58	220	2e-06	28.2
LXL04_030634	`PF01494.26`	FAD_binding_3	136	347	6.6e-12	46.0
LXL04_030634	`PF22578.3`	GGR_cat	245	286	7.5e-06	26.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA67`	Arabidopsis thaliana	Geranylgeranyl diphosphate reductase, chloroplastic	82.013%	Swiss-Prot	strong database homology
`Q6Z2T6`	Oryza sativa subsp. japonica	Geranylgeranyl diphosphate reductase, chloroplastic	79.487%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card