LXL04_030523 | RubberDandelionOmics

Gene overview

LXL04_030523

Reference: OH-1004 Chr: Chr06 Coordinates: 118100699-118102792 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · LXL04_030523|LXL04_030523|OH1004|cDNA

ATGAGCTTCAGACTTGGTCTGAGACGTTCGGAGTCGAGTTCTCTGGCCAAGGCTATGGCGCAGGAATTGAACTCTTCAGCGCCGGCAACCGCAACCGtaacagcaacagcaacagcaaccGCCGCCACTGTAACTTCAGCGTCAACGACGAAGAAATCGCTATGGCCGTCTGTTCTTCGTTGGATTCCCACATCTACGGATCACATTATTGCCGCTGAAAAACGCCTTCTATCTCTTGTCAAGACACCATATACACAAGA...

CDS

Download CDS FASTA

1326 bp · LXL04_030523|LXL04_030523|OH1004|CDS

ATGAGCTTCAGACTTGGTCTGAGACGTTCGGAGTCGAGTTCTCTGGCCAAGGCTATGGCGCAGGAATTGAACTCTTCAGCGCCGGCAACCGCAACCGTAACAGCAACAGCAACAGCAACCGCCGCCACTGTAACTTCAGCGTCAACGACGAAGAAATCGCTATGGCCGTCTGTTCTTCGTTGGATTCCCACATCTACGGATCACATTATTGCCGCTGAAAAACGCCTTCTATCTCTTGTCAAGACACCATATACACAAGA...

Protein

Download Protein FASTA

441 aa · LXL04_030523|LXL04_030523|OH1004|PROTEIN

MSFRLGLRRSESSSLAKAMAQELNSSAPATATVTATATATAATVTSASTTKKSLWPSVLRWIPTSTDHIIAAEKRLLSLVKTPYTQELVNIGSGPPGSKVRWFRSTSNEPRFINTITFDSKPDSPTLVMVHGYAASQGFFFKNFDTLAKHFRIIAIDQLGWGGSSRPDFTCTSTEETEAWFIDSFEEWRKAKNLSNFVLLGHSFGGYIASKYALKHPEHVQHLILVGPAGFTSETEHKSERLTKFQATWTGAVLNHLWES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030523`
TK1151 ID	TkA07G409670
OH-1004 ID	LXL04_030523
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030523

Location Chr06:118100699-118102792 (-)

Description Similar to Os09g0520200: Probable 1-acylglycerol-3-phosphate O-acyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24160`	Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis.	At4g24160, a soluble acyl-coenzyme A-dependent lysophosphatidic acid acyltransferase.2009 · DOI: 10.1104/pp.109.144261

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0520200`	Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030523 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006654 phosphatidic acid biosynthetic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0036152 phosphatidylethanolamine acyl-chain remodeling Biological Process

GO:0055088 lipid homeostasis Biological Process

GO:0055089 fatty acid homeostasis Biological Process

GO:0055091 phospholipid homeostasis Biological Process

GO:0070291 N-acylethanolamine metabolic process Biological Process

GO:0070292 N-acylphosphatidylethanolamine metabolic process Biological Process

GO:0070328 triglyceride homeostasis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT4G24160

bta:509896

dosa:Os09g0520200

hsa:63874

mmu:105501

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.467

Rank 1 · LXL04_030523 · OH-1004

Plastid0.159

Rank 2 · LXL04_030523 · OH-1004

Peroxisome0.147

Rank 3 · LXL04_030523 · OH-1004

Cytoplasm0.140

Rank 4 · LXL04_030523 · OH-1004

Endoplasmic reticulum0.090

Rank 5 · LXL04_030523 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561.27Abhydrolase_1125-412 aa

PF12146.16Hydrolase_4126-258 aa

PF12697.14Abhydrolase_6127-415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030523	`PF00561.27`	Abhydrolase_1	125	412	1.3e-27	97.7
LXL04_030523	`PF12146.16`	Hydrolase_4	126	258	2.3e-17	63.9
LXL04_030523	`PF12697.14`	Abhydrolase_6	127	415	7.2e-18	66.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22975`	Arabidopsis thaliana	1-acylglycerol-3-phosphate O-acyltransferase	73.879%	Swiss-Prot	strong database homology
`Q0J0A4`	Oryza sativa subsp. japonica	Probable 1-acylglycerol-3-phosphate O-acyltransferase	73.469%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card