RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_030517
Reference: OH-1004 Chr: Chr06 Coordinates: 117969071-117973684 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3648 bp · LXL04_030517|LXL04_030517|OH1004|cDNA

ATgaagatgttgacgaagtttgAAACGAAAAGCAATAGAGTGAAAGGGCTGAGTTTCCACAGCAAGAGACCATGGATCTTGGCCAGTCTCCACAGCGGTGTGATTCAGCTATGGGATTACAGAATGGGAACTCTCATCGATCGATTTGACGAGCATGATGGACCCGTTCGTGGTGTTCATTTCCACAAATCACAACCTCTTTTCGTCTCCGGAGGAGATGATTACAAGATCAAAGTATGGAACTACAAACTACACAGATG...

CDS

Download CDS FASTA

3648 bp · LXL04_030517|LXL04_030517|OH1004|CDS

ATGAAGATGTTGACGAAGTTTGAAACGAAAAGCAATAGAGTGAAAGGGCTGAGTTTCCACAGCAAGAGACCATGGATCTTGGCCAGTCTCCACAGCGGTGTGATTCAGCTATGGGATTACAGAATGGGAACTCTCATCGATCGATTTGACGAGCATGATGGACCCGTTCGTGGTGTTCATTTCCACAAATCACAACCTCTTTTCGTCTCCGGAGGAGATGATTACAAGATCAAAGTATGGAACTACAAACTACACAGATG...

Protein

Download Protein FASTA

1215 aa · LXL04_030517|LXL04_030517|OH1004|PROTEIN

MKMLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCALFHPKDDLVVSASLDQTVRVWDISALRKKTVSPADDILRLGQMNTDFFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_030517
TK1151 IDTkA08G112160
OH-1004 IDLXL04_030517
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)86.000
Protein coverage (%)TK1151 100.000 / OH-1004 99.835
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_030517
LocationChr06:117969071-117973684 (-)
DescriptionSimilar to At1g62020: Coatomer subunit alpha-1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g62020 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
At2g21390 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0127800 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Os03g0711400 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Os03g0711500 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030517 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006886 intracellular protein transport Biological Process
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process
GO:0006891 intra-Golgi vesicle-mediated transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0030126 COPI vesicle coat Cellular Component
GO:0005198 structural molecule activity Molecular Function
KEGG gene cross-reference
ath:AT1G62020
ath:AT2G21390
dosa:Os03g0711400
dosa:Os03g0711500
dosa:Os09g0127800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.568
Rank 1 · LXL04_030517 · OH-1004
Nucleus0.268
Rank 2 · LXL04_030517 · OH-1004
Golgi apparatus0.142
Rank 3 · LXL04_030517 · OH-1004
Lysosome / Vacuole0.105
Rank 4 · LXL04_030517 · OH-1004
Endoplasmic reticulum0.098
Rank 5 · LXL04_030517 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25175.2Beta-prop_WDR53-92 aa
PF25171.2Beta-prop_WDR36-Utp21_1st3-81 aa
PF25173.2Beta-prop_WDR3_1st4-166 aa
PF24796.2WDR554-166 aa
PF24807.2WD40_CDC20-Fz5-164 aa
PF25174.2Beta-prop_THOC37-129 aa
PF23414.2Beta-prop_EML_215-172 aa
PF23381.2Beta-prop_IFT122_1st16-89 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_030517PF25175.2Beta-prop_WDR53922.4e-57195.2
LXL04_030517PF25171.2Beta-prop_WDR36-Utp21_1st3814.4e-2072.9
LXL04_030517PF25173.2Beta-prop_WDR3_1st41661.7e-53181.8
LXL04_030517PF24796.2WDR5541668.2e-2588.2
LXL04_030517PF24807.2WD40_CDC20-Fz51648.2e-2485.1
LXL04_030517PF25174.2Beta-prop_THOC371294.8e-44151.1
LXL04_030517PF23414.2Beta-prop_EML_2151722e-2177.3
LXL04_030517PF23381.2Beta-prop_IFT122_1st16897.9e-41140.9
LXL04_030517PF25172.2Beta-prop_WDR3_2nd17851.3e-28100.8
LXL04_030517PF25391.2WD40_Gbeta271251.5e-1867.6
LXL04_030517PF24817.2WD40_WDHD1_1st311321.8e-32113.4
LXL04_030517PF00400.39WD4044811.6e-48161.8
LXL04_030517PF25168.2Beta-prop_WDR36-Utp21_2nd511683.2e-2796.4
LXL04_030517PF24105.2Beta-prop_CAF1B_HIR1511705.3e-1865.9
LXL04_030517PF24782.3WD40_MABP1-WDR62_2nd521232.2e-1144.0
LXL04_030517PF24814.2WD40_Prp19621699.9e-45153.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q94A40Arabidopsis thalianaCoatomer subunit alpha-179.918%Swiss-Protstrong database homology
Q9SJT9Arabidopsis thalianaCoatomer subunit alpha-278.296%Swiss-Protstrong database homology
Q0J3D9Oryza sativa subsp. japonicaCoatomer subunit alpha-375.941%Swiss-Protstrong database homology
Q9AUR8Oryza sativa subsp. japonicaCoatomer subunit alpha-175.941%Swiss-Protstrong database homology
Q9AUR7Oryza sativa subsp. japonicaCoatomer subunit alpha-275.696%Swiss-Protstrong database homology

JBrowse

View in Genome Browser