LXL04_030499 | RubberDandelionOmics

Gene overview

LXL04_030499

Reference: OH-1004 Chr: Chr06 Coordinates: 117348536-117350424 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1154 bp · LXL04_030499|LXL04_030499|OH1004|cDNA

AATTCATATCATATAAATCTTTTTTATTACGATTATGTAGAAAAATGGCAACACAAGTTGAACCACCAAATGGGGTTAGATCAGAAGGGAAGCATTATTTTTCAATGTGGCAGGCATTATTTGAAATTGACACCAAATATGTTCCAATTAAGCCAATTGGAAGAGGCGCATATGGGATTGTCTGCTCTTCTGTAAACCGTGAAACAAATGAGAAGGTTGCAATTAAGAAGATTCATAATGCATTTGATAACCGAATTGAT...

CDS

Download CDS FASTA

1110 bp · LXL04_030499|LXL04_030499|OH1004|CDS

ATGGCAACACAAGTTGAACCACCAAATGGGGTTAGATCAGAAGGGAAGCATTATTTTTCAATGTGGCAGGCATTATTTGAAATTGACACCAAATATGTTCCAATTAAGCCAATTGGAAGAGGCGCATATGGGATTGTCTGCTCTTCTGTAAACCGTGAAACAAATGAGAAGGTTGCAATTAAGAAGATTCATAATGCATTTGATAACCGAATTGATGCTTTGAGAACATTAAGGGAACTTAAGCTTCTTAGGCATCTAAG...

Protein

Download Protein FASTA

369 aa · LXL04_030499|LXL04_030499|OH1004|PROTEIN

MATQVEPPNGVRSEGKHYFSMWQALFEIDTKYVPIKPIGRGAYGIVCSSVNRETNEKVAIKKIHNAFDNRIDALRTLRELKLLRHLRHENVIALKDVMVPIHRRSFKDVYLVYELMDTDLHQIIKSSQALTNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLARTRTTKDQFMTEYVVTRWYRAPELLLCCDNYGTSIDIWSVGCIFAELLGRKPLFPGTECLNQLRLIINILGSQTEEDIRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030499`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030499

Location Chr06:117348536-117350424 (-)

Description Similar to NTF3: Mitogen-activated protein kinase homolog NTF3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10210`	Mitogen-activated protein kinase 1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0699400`	Mitogen-activated protein kinase 4.	No verified direct reference in this release
`Os02g0148100`	Mitogen-activated protein kinase 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030499 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004707 MAP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10210

dosa:Os02g0148100

dosa:Os06g0699400

osa:4328297

osa:4341956

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.615

Rank 1 · LXL04_030499 · OH-1004

Cytoplasm0.591

Rank 2 · LXL04_030499 · OH-1004

Cell membrane0.063

Rank 3 · LXL04_030499 · OH-1004

Mitochondrion0.045

Rank 4 · LXL04_030499 · OH-1004

Endoplasmic reticulum0.030

Rank 5 · LXL04_030499 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase33-319 aa

PF07714.24PK_Tyr_Ser-Thr36-228 aa

PF06293.21Kdo62-187 aa

PF03109.23ABC190-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030499	`PF00069.32`	Pkinase	33	319	3.1e-68	230.7
LXL04_030499	`PF07714.24`	PK_Tyr_Ser-Thr	36	228	3.5e-31	109.2
LXL04_030499	`PF06293.21`	Kdo	62	187	4e-07	30.4
LXL04_030499	`PF03109.23`	ABC1	90	188	4.5e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39021`	Arabidopsis thaliana	Mitogen-activated protein kinase 1	82.645%	Swiss-Prot	strong database homology
`Q5Z859`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 4	80.978%	Swiss-Prot	strong database homology
`Q6Z437`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 3	80.874%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card