LXL04_030482 | RubberDandelionOmics

Gene overview

LXL04_030482

Reference: OH-1004 Chr: Chr06 Coordinates: 116870606-116872036 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · LXL04_030482|LXL04_030482|OH1004|cDNA

ATGGGAACCCTGGGAAGAGCCGCATACACATTCGGATTCTGGATCCGCGAAACTGGACAAGCCATGGATCGTCTCGGTTCACGCCTCCAGGGCAACAACTACTTCAAAGAACAACTTTCCAGACATCGAACTCTTATGAATGTGTACAACAAAGCCCCTACAGTTGCTAAAGATGCATTTGTGGCCCCAAGTGCTTCTATCATCGGGGATGTTCAAGTGGGAGCAGGTTCATCTATTTGGTACGGATGTGTTCTCAGAGG...

CDS

Download CDS FASTA

732 bp · LXL04_030482|LXL04_030482|OH1004|CDS

ATGGGAACCCTGGGAAGAGCCGCATACACATTCGGATTCTGGATCCGCGAAACTGGACAAGCCATGGATCGTCTCGGTTCACGCCTCCAGGGCAACAACTACTTCAAAGAACAACTTTCCAGACATCGAACTCTTATGAATGTGTACAACAAAGCCCCTACAGTTGCTAAAGATGCATTTGTGGCCCCAAGTGCTTCTATCATCGGGGATGTTCAAGTGGGAGCAGGTTCATCTATTTGGTACGGATGTGTTCTCAGAGG...

Protein

Download Protein FASTA

243 aa · LXL04_030482|LXL04_030482|OH1004|PROTEIN

MGTLGRAAYTFGFWIRETGQAMDRLGSRLQGNNYFKEQLSRHRTLMNVYNKAPTVAKDAFVAPSASIIGDVQVGAGSSIWYGCVLRGDVNSISIGSGTNIQDHSLVHVAKSNLPGKVHPIVIGDNVTIGHSAVLHGCTVENEAFVGMKATLLDGVVVEKHAMVAAGALVRQGTRIPTGEVWGGNPAKFLRKLKDEEIAFISKSATNYASLAKDHADENGKALDKDEFLKVFQKKANVDPSLIQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030482`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030482

Location Chr06:116870606-116872036 (+)

Description Similar to GAMMACA1: Gamma carbonic anhydrase 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19580`	Enzyme involved in the catabolism of H(2)CO(3) but that does not mediates the reversible hydration of carbon dioxide.	No verified direct reference in this release
`At5g66510`	Enzyme involved in the catabolism of H(2)CO(3) but that does not mediates the reversible hydration of carbon dioxide.	No verified direct reference in this release
`At1g47260`	May participate in carbonic acid breakdown but does not mediate reversible hydration of carbon dioxide.	Disruption of a nuclear gene encoding a mitochondrial gamma carbonic anhydrase reduces complex I and supercomplex I + III2 levels and alters mitochondrial physiology in Arabidopsis.2005 · DOI: 10.1016/j.jmb.2005.04.062 Recombinant plant gamma carbonic anhydrase homotrimers bind inorganic carbon.2009 · DOI: 10.1016/j.febslet.2009.09.055
`At5g63510`	Involved in complex I assembly in mitochondria and respiration.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030482 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009853 photorespiration Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0070207 protein homotrimerization Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009536 plastid Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

KEGG gene cross-reference

ath:AT1G19580

ath:AT1G47260

ath:AT5G63510

ath:AT5G66510

ddi:DDB_G0288155

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.890

Rank 1 · LXL04_030482 · OH-1004

Cytoplasm0.117

Rank 2 · LXL04_030482 · OH-1004

Nucleus0.064

Rank 3 · LXL04_030482 · OH-1004

Cell membrane0.038

Rank 4 · LXL04_030482 · OH-1004

Peroxisome0.026

Rank 5 · LXL04_030482 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00132.31Hexapep54-87 aa

PF25084.2LbH_EIF2B91-176 aa

PF00132.31Hexapep136-170 aa

PF28366.1GAMMACA1_C197-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030482	`PF00132.31`	Hexapep	54	87	1.2e-16	60.3
LXL04_030482	`PF25084.2`	LbH_EIF2B	91	176	6.8e-08	33.2
LXL04_030482	`PF00132.31`	Hexapep	136	170	1.2e-16	60.3
LXL04_030482	`PF28366.1`	GAMMACA1_C	197	235	1.5e-11	44.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWR5`	Arabidopsis thaliana	Gamma carbonic anhydrase 1, mitochondrial	80.342%	Swiss-Prot	strong database homology
`Q94AU7`	Arabidopsis thaliana	Gamma carbonic anhydrase 3, mitochondrial	73.077%	Swiss-Prot	strong database homology
`Q9C6B3`	Arabidopsis thaliana	Gamma carbonic anhydrase 2, mitochondrial	72.650%	Swiss-Prot	strong database homology
`Q9FMV1`	Arabidopsis thaliana	Gamma carbonic anhydrase-like 1, mitochondrial	40.909%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card