LXL04_030443 | RubberDandelionOmics

Gene overview

LXL04_030443

Reference: OH-1004 Chr: Chr06 Coordinates: 116067892-116069962 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1317 bp · LXL04_030443|LXL04_030443|OH1004|cDNA

ATGGCGGGTCCTGTGGGTCGTAGAGGAACCAACGCGTCGCAATCGGTACGTGGATCTAGAATTGCCGTTGCAATTGTCATCGGAATTTTACTCGGATGCGTCTTCGCAGTTTTATACCCTCACGGCCTCTTCTCCGACAATTCCAATCCGGCTTCTCATTTCCGGAGTCGCCGTCTTTCCAAATCGAATCCACAGATTGGATCAACTTGTGAAACTACAGATCAAGTCAACAAATTAAAATCAGATATTACAGATCTATC...

CDS

Download CDS FASTA

1317 bp · LXL04_030443|LXL04_030443|OH1004|CDS

ATGGCGGGTCCTGTGGGTCGTAGAGGAACCAACGCGTCGCAATCGGTACGTGGATCTAGAATTGCCGTTGCAATTGTCATCGGAATTTTACTCGGATGCGTCTTCGCAGTTTTATACCCTCACGGCCTCTTCTCCGACAATTCCAATCCGGCTTCTCATTTCCGGAGTCGCCGTCTTTCCAAATCGAATCCACAGATTGGATCAACTTGTGAAACTACAGATCAAGTCAACAAATTAAAATCAGATATTACAGATCTATC...

Protein

Download Protein FASTA

438 aa · LXL04_030443|LXL04_030443|OH1004|PROTEIN

MAGPVGRRGTNASQSVRGSRIAVAIVIGILLGCVFAVLYPHGLFSDNSNPASHFRSRRLSKSNPQIGSTCETTDQVNKLKSDITDLSTTNDELKKQVRDLTAKLQASEQKNGQSDQQMVTVVTTDPQKPGPFGTVKGSSTNPTILPDPTVNPRLAKILEKITTKKEVIVALANSNVKSMLEVSVSSIKKAGISNYLVVALDDGIVDFCKENDVAYYKRDPDEGIDSVAKSGGNHAVSGLKFRILREFLQLGYGVLLSDVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030443`
TK1151 ID	TkA07G403380
OH-1004 ID	LXL04_030443
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030443

Location Chr06:116067892-116069962 (-)

Description Similar to RRA3: Arabinosyltransferase RRA3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19360`	Plays a role in the arabinosylation of cell wall components.	No verified direct reference in this release
`At1g75110`	Plays a role in the arabinosylation of cell wall components.	Molecular characterization of two Arabidopsis thaliana glycosyltransferase mutants, rra1 and rra2, which have a reduced residual arabinose content in a polymer tightly associated with the cellulosic wall residue.2007 · DOI: 10.1007/s11103-007-9162-y
`At1g75120`	Plays a role in the arabinosylation of cell wall components.	Molecular characterization of two Arabidopsis thaliana glycosyltransferase mutants, rra1 and rra2, which have a reduced residual arabinose content in a polymer tightly associated with the cellulosic wall residue.2007 · DOI: 10.1007/s11103-007-9162-y
`At1g70630`	Beta-arabinofuranosyltransferase that transfers specifically an arabinosyl residue from UDP-arabinofuranose to the monosaccharide galactose or beta-methyl-galactoside in vitro.	No verified direct reference in this release
`At2g35610`	Plays a role in the arabinosylation of cell wall components.	Identification of plant cell wall mutants by means of a forward chemical genetic approach using hydrolases.2009 · DOI: 10.1073/pnas.0905434106 Cell wall properties play an important role in the emergence of lateral root primordia from the parent root.2014 · DOI: 10.1093/jxb/eru056

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030443 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0031506 cell wall glycoprotein biosynthetic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080147 root hair cell development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

KEGG gene cross-reference

ath:AT1G19360

ath:AT1G70630

ath:AT1G75110

ath:AT1G75120

ath:AT2G35610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.802

Rank 1 · LXL04_030443 · OH-1004

Endoplasmic reticulum0.132

Rank 2 · LXL04_030443 · OH-1004

Cytoplasm0.082

Rank 3 · LXL04_030443 · OH-1004

Cell membrane0.056

Rank 4 · LXL04_030443 · OH-1004

Extracellular0.044

Rank 5 · LXL04_030443 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03407.23Nucleotid_trans192-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030443	`PF03407.23`	Nucleotid_trans	192	411	6.9e-48	164.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LN62`	Arabidopsis thaliana	Arabinosyltransferase RRA3	70.276%	Swiss-Prot	strong database homology
`Q9C9Q5`	Arabidopsis thaliana	Arabinosyltransferase RRA2	65.820%	Swiss-Prot	strong database homology
`Q9C9Q6`	Arabidopsis thaliana	Arabinosyltransferase RRA1	59.811%	Swiss-Prot	strong database homology
`F4I6V0`	Arabidopsis thaliana	Beta-arabinofuranosyltransferase RAY1	23.944%	Swiss-Prot	weak database homology
`Q8VXZ5`	Arabidopsis thaliana	Arabinosyltransferase XEG113	27.041%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card