LXL04_030396 | RubberDandelionOmics

Gene overview

LXL04_030396

Reference: OH-1004 Chr: Chr06 Coordinates: 115365719-115368091 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2238 bp · LXL04_030396|LXL04_030396|OH1004|cDNA

ATGCCTCTTCCTGATTTTGCTTTTGCTGCTATCATTAATGTTTGTGAAACTTATATCAATCAAATGGGAAAGAAAAAAACAGATGAGGGCGGAGAGAAGAGCAAGCAAACCAACAAAgaaggaaagaaagaaaaactATCCGTCTCAGCCATGCTTGCCAACATGGACCAAAAACCCGAAAAACCAAAGAAAGCAACCTCATcaacctccaccaccaccacccgcAACCCCAAATCCAAACCCCCTCAAAAGCTCCAGAC...

CDS

Download CDS FASTA

2238 bp · LXL04_030396|LXL04_030396|OH1004|CDS

ATGCCTCTTCCTGATTTTGCTTTTGCTGCTATCATTAATGTTTGTGAAACTTATATCAATCAAATGGGAAAGAAAAAAACAGATGAGGGCGGAGAGAAGAGCAAGCAAACCAACAAAGAAGGAAAGAAAGAAAAACTATCCGTCTCAGCCATGCTTGCCAACATGGACCAAAAACCCGAAAAACCAAAGAAAGCAACCTCATCAACCTCCACCACCACCACCCGCAACCCCAAATCCAAACCCCCTCAAAAGCTCCAGAC...

Protein

Download Protein FASTA

745 aa · LXL04_030396|LXL04_030396|OH1004|PROTEIN

MPLPDFAFAAIINVCETYINQMGKKKTDEGGEKSKQTNKEGKKEKLSVSAMLANMDQKPEKPKKATSSTSTTTTRNPKSKPPQKLQTSYADIDLPPSDDEEDEVSEDESQLGQPKKLTRKERAHDRTLEISITEKDIKKREKKDMIHAQVIEQAKQEALKDDRDAFTVVIGSRASVLDGENDADANVKDITVDNFSVSARGKELMKNASVKISHGKRYGLVGPNGKGKSTLLKLLAWRKIPVPKNIDVLLVEQEIVGDDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030396`
TK1151 ID	TkA07G401780
OH-1004 ID	LXL04_030396
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.181 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030396

Location Chr06:115365719-115368091 (-)

Description Similar to ABCF4: ABC transporter F family member 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54540`	ABC transporter F family member 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030396 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006413 translational initiation Biological Process

GO:0045727 positive regulation of translation Biological Process

GO:0005635 nuclear envelope Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G54540

hsa:23

ptr:462543

rno:85493

ssc:100144452

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.593

Rank 1 · LXL04_030396 · OH-1004

Nucleus0.449

Rank 2 · LXL04_030396 · OH-1004

Endoplasmic reticulum0.064

Rank 3 · LXL04_030396 · OH-1004

Cell membrane0.053

Rank 4 · LXL04_030396 · OH-1004

Mitochondrion0.050

Rank 5 · LXL04_030396 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran206-368 aa

PF00005.34ABC_tran535-670 aa

PF13304.13AAA_21549-588 aa

PF13304.13AAA_21608-701 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030396	`PF00005.34`	ABC_tran	206	368	6.9e-49	166.7
LXL04_030396	`PF00005.34`	ABC_tran	535	670	6.9e-49	166.7
LXL04_030396	`PF13304.13`	AAA_21	549	588	6.9e-20	72.9
LXL04_030396	`PF13304.13`	AAA_21	608	701	6.9e-20	72.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1H3`	Arabidopsis thaliana	ABC transporter F family member 4	75.474%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card