LXL04_030364 | RubberDandelionOmics

Gene overview

LXL04_030364

Reference: OH-1004 Chr: Chr06 Coordinates: 114905767-114911422 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1158 bp · LXL04_030364|LXL04_030364|OH1004|cDNA

ATGGCAGCAAAGGTTTTGTTTTTCGAAGGAAGACGCGAAGAAAAAGACGTGGACTCGGATCATAATATCGCCTCAATTCGATTCGATTGTTCATCTTCTGTGATCACACTTAAACCCTCGGACGTTAACTATCGTATGATGGGGGGAAGTTCAATTGATGACGATTGGGAGTTCGCCACTCCATTGAACGGACTTAGGACTCTTGTTTTGGTTGGAAGAACCGGGAATGGGAAAAGTGCAACCGGGAATAGCATCCTTGG...

CDS

Download CDS FASTA

1158 bp · LXL04_030364|LXL04_030364|OH1004|CDS

ATGGCAGCAAAGGTTTTGTTTTTCGAAGGAAGACGCGAAGAAAAAGACGTGGACTCGGATCATAATATCGCCTCAATTCGATTCGATTGTTCATCTTCTGTGATCACACTTAAACCCTCGGACGTTAACTATCGTATGATGGGGGGAAGTTCAATTGATGACGATTGGGAGTTCGCCACTCCATTGAACGGACTTAGGACTCTTGTTTTGGTTGGAAGAACCGGGAATGGGAAAAGTGCAACCGGGAATAGCATCCTTGG...

Protein

Download Protein FASTA

385 aa · LXL04_030364|LXL04_030364|OH1004|PROTEIN

MAAKVLFFEGRREEKDVDSDHNIASIRFDCSSSVITLKPSDVNYRMMGGSSIDDDWEFATPLNGLRTLVLVGRTGNGKSATGNSILGKREFLSRASSAGVTSTSELRTTVLKDGQMLNVIDTPGLFDSSVDTEFIGKEIVKCINMAREGIHAVLVVLSVRNRFSKEEEAAINSLRTLFGNKINDYMIVVFTGGDELEENEETLEDFLKDCPVPLKETLGLCGDRCVLFDNKTKDQRKKAQQLHELLSLVNMVLTKNNGKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030364`
TK1151 ID	TkA07G399800
OH-1004 ID	LXL04_030364
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 88.312 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030364

Location Chr06:114905767-114911422 (-)

Description Similar to IAN9: Immune-associated nucleotide-binding protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33970`	Immune-associated nucleotide-binding protein 9.	No verified direct reference in this release
`At4g09950`	Immune-associated nucleotide-binding protein 13.	No verified direct reference in this release
`At1g33960`	Immune-associated nucleotide-binding protein 8.	No verified direct reference in this release
`At1g33950`	Immune-associated nucleotide-binding protein 7.	No verified direct reference in this release
`At4g09940`	Immune-associated nucleotide-binding protein 12.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030364 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT1G33950

ath:AT1G33960

ath:AT1G33970

ath:AT4G09940

ath:AT4G09950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517

Rank 1 · LXL04_030364 · OH-1004

Cell membrane0.233

Rank 2 · LXL04_030364 · OH-1004

Nucleus0.179

Rank 3 · LXL04_030364 · OH-1004

Golgi apparatus0.162

Rank 4 · LXL04_030364 · OH-1004

Endoplasmic reticulum0.161

Rank 5 · LXL04_030364 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04548.23AIG167-279 aa

PF01926.30MMR_HSR168-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030364	`PF04548.23`	AIG1	67	279	1.3e-78	263.9
LXL04_030364	`PF01926.30`	MMR_HSR1	68	176	3.5e-09	37.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HT21`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 9	60.831%	Swiss-Prot	strong database homology
`Q9T0F4`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 13	45.104%	Swiss-Prot	moderate database homology
`P54120`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 8	43.966%	Swiss-Prot	moderate database homology
`Q9C8V2`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 7	49.438%	Swiss-Prot	moderate database homology
`Q9T0F3`	Arabidopsis thaliana	Immune-associated nucleotide-binding protein 12	44.904%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card